Property Summary

NCBI Gene PubMed Count 128
PubMed Score 4022.89
PubTator Score 3173.44

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 3.03633977205588E-11
medulloblastoma 1524 4.82664765706124E-8
osteosarcoma 7933 3.1197589913692E-6
atypical teratoid / rhabdoid tumor 4369 1.2671989085316E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 3.41841671563244E-5
primitive neuroectodermal tumor 3031 4.63846164862791E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 5.06254016163158E-5
glioblastoma 5572 9.92506954692539E-5
pilocytic astrocytoma 3086 2.1925063434253E-4
medulloblastoma, large-cell 6234 0.00130624642536449
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00145950908448852
lung carcinoma 2844 0.00169635521548131
colon cancer 1475 0.00240515130038045
pediatric high grade glioma 2712 0.00298141962762154
oligodendroglioma 2849 0.00724362761959091
astrocytic glioma 2241 0.00806095999044851
ependymoma 2514 0.0105648812023651
Breast cancer 3099 0.0275551869816365


  Differential Expression (18)


Accession P01282 Q5TCY8 Q5TCY9 Q96QK3
Symbols PHM27




2RRH   2RRI  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish EggNOG Inparanoid

 GO Component (1)

Gene RIF (96)

27013676 optogenetically activating single VIPs in live mice while recording the activity of nearby neurons, we find that VIPs break open a hole in blanket inhibition.
26206287 a differential effect of VIP on the expression of TNFalpha and IL-6 receptors, since VIP was only able to decreased expression in LPS-stimulated monocytes but not in 4/74-infected monocytes.
25973863 Skin VIP expression, a marker of sudomotor innervation, was significantly lower in patients with familial transthyretin amyloid neuropathy compared to controls.
25957307 VIP promotes Th17 polarization of memory Th cells in early arthritis.
25921596 The circadian rhythm amplitude of motor activity in both Alzheimer disease subjects and age-matched controls is correlated with the number of vasoactive intestinal peptide-expressing suprachiasmatic nucleus neurons.
25574088 Alterations in VIP expression may play a role in irritable bowel syndrome.
24788249 VIP regulates CFTR membrane expression and function in Calu-3 cells by increasing its interaction with NHERF1 and P-ERM in a VPAC1- and PKCepsilon-dependent manner.
24673487 Interictal CGRP and, to a lesser degree, VIP levels measured in peripheral blood are of great help in predicting response of chronic migraine patients to Onabotulinumtoxin type A
24492467 VIP induced expression of CCL5, one of the main chemokines involved in T cell recruitment.
24409325 Serum levels of vasoactive intestinal peptide as a prognostic marker in early arthritis.

AA Sequence

MAVKKYLNSILNGKRSSEGESPDFPEELEK                                            141 - 170

Text Mined References (129)

PMID Year Title
27013676 2016 Opening Holes in the Blanket of Inhibition: Localized Lateral Disinhibition by VIP Interneurons.
26206287 2015 Vasoactive intestinal peptide (VIP) differentially affects inflammatory immune responses in human monocytes infected with viable Salmonella or stimulated with LPS.
25973863 2015 Sudomotor innervation in transthyretin amyloid neuropathy: Pathology and functional correlates.
25957307 2015 Th17 polarization of memory Th cells in early arthritis: the vasoactive intestinal peptide effect.
25921596 2015 Suprachiasmatic neuron numbers and rest-activity circadian rhythms in older humans.
25574088 2015 Altered vasoactive intestinal peptides expression in irritable bowel syndrome patients and rats with trinitrobenzene sulfonic acid-induced colitis.
25416956 2014 A proteome-scale map of the human interactome network.
24788249 2014 VIP regulates CFTR membrane expression and function in Calu-3 cells by increasing its interaction with NHERF1 and P-ERM in a VPAC1- and PKC?-dependent manner.
24673487 2014 CGRP and VIP levels as predictors of efficacy of Onabotulinumtoxin type A in chronic migraine.
24492467 2014 VIP contribution to the decidualization program: regulatory T cell recruitment.