Property Summary

NCBI Gene PubMed Count 132
PubMed Score 4092.50
PubTator Score 3173.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -1.700 5.0e-02
astrocytic glioma -2.700 8.1e-03
Astrocytoma, Pilocytic -2.300 2.1e-04
atypical teratoid / rhabdoid tumor -2.500 1.3e-05
Breast cancer -2.600 2.8e-02
colon cancer -4.600 2.4e-03
ependymoma -3.100 1.1e-02
glioblastoma -1.900 4.5e-05
group 3 medulloblastoma -2.500 3.5e-02
intraductal papillary-mucinous adenoma (... -3.900 3.4e-05
intraductal papillary-mucinous carcinoma... -4.000 5.1e-05
intraductal papillary-mucinous neoplasm ... -3.900 1.5e-03
lung carcinoma 1.500 1.7e-03
medulloblastoma, large-cell -2.900 1.3e-03
oligodendroglioma -2.900 7.2e-03
osteosarcoma -2.161 3.1e-06
primitive neuroectodermal tumor -3.100 4.6e-05
psoriasis -1.300 3.0e-11

Protein-protein Interaction (4)

Gene RIF (100)

AA Sequence

MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDT      1 - 70
PYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPVKRHSDAVFTDNYTRLRKQ     71 - 140
MAVKKYLNSILNGKRSSEGESPDFPEELEK                                            141 - 170
//

Text Mined References (133)

PMID Year Title