Property Summary

Ligand Count 103
NCBI Gene PubMed Count 269
PubMed Score 17114.41
PubTator Score 2331.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (4)

Gene RIF (228)

AA Sequence

MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRR      1 - 70
AQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVE     71 - 140
ELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK                                  141 - 180
//

Text Mined References (269)

PMID Year Title