Property Summary

NCBI Gene PubMed Count 245
Grant Count 1,373
R01 Count 735
Funding $136,044,428.54
PubMed Score 16535.37
PubTator Score 2331.05

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Synonym

Accession P01275 A6NN65 Q53TP6
Symbols GLP1
GLP2
GRPP

Gene

GCG

PANTHER Protein Class (2)

PDB

2G49   1BH0   1D0R   1NAU   2L63   2L64   2M5P   2M5Q   3IOL   4APD   4ZGM  

Gene RIF (206)

PMID Text
26842302 GLP-1 secretion increased in response to inflammatory stimuli in humans, which was associated to parameters of glucose metabolism and best predicted by IL6.
26762368 Data suggest that endocrine responses differ between jejunal and gastric enteral feeding, with higher peak plasma CCK (cholecystokinin), PYY (peptide YY), and GLP-1/2 (glucagon-like peptides 1/2) concentrations being attained after jejunal feeding.
26752550 There is minor contribution of endogenous GLP-1 and GLP-2 to postprandial lipemia in obese men.
26718419 Data suggest that capsaicin, an appetite suppressant dietary supplement (here, administered via intraduodenal infusion), does not act via alteration of secretion of satiety hormones GLP-1 (GLP-1) and PYY (peptide YY).
26672094 Glucagon circulates in patients without a pancreas and glucose stimulation of the gastrointestinal tract elicits significant hyperglucagonemia in these patients.
26571400 The PKC-dependent effect of GLP-1 on membrane potential and electrical activity was mediated by activation of Na(+)-permeable TRPM4 and TRPM5 channels by mobilization of intracellular Ca(2+) from thapsigargin-sensitive Ca(2+) stores
26315270 GLP-1 increases PGC-1(alpha) expression by downregulating miR-23a in liver cells.
26294429 GLP-1 cleavage product GLP-1(9-36)(amide) reverses the hyperglycemia induced persistent left shift of the glucose concentration-reactive oxygen species (ROS) dose-response curve, thereby normalizing persistent overproduction of ROS and its consequences.
26270730 Data show that NCI-H716 cells were immunostained for tumor necrosis factor receptor TNFR1, and TNFalpha treatment enhances glucagon-like peptide-1 (GLP-1) secretion.
25984632 active GLP-1 produced in the islet stimulates cholecystokinin production and secretion in a paracrine manner via cyclic AMP and CREB.
More...

AA Sequence

MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRR      1 - 70
AQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVE     71 - 140
ELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK                                  141 - 180
//

Text Mined References (245)

PMID Year Title
26842302 2016 Interleukin-6 predicts inflammation-induced increase of Glucagon-like peptide-1 in humans in response to cardiac surgery with association to parameters of glucose metabolism.
26762368 2016 Jejunal feeding is followed by a greater rise in plasma cholecystokinin, peptide YY, glucagon-like peptide 1, and glucagon-like peptide 2 concentrations compared with gastric feeding in vivo in humans: a randomized trial.
26752550 2016 Minor Contribution of Endogenous GLP-1 and GLP-2 to Postprandial Lipemia in Obese Men.
26718419 2016 Capsaicin-induced satiety is associated with gastrointestinal distress but not with the release of satiety hormones.
26672094 2016 Evidence of Extrapancreatic Glucagon Secretion in Man.
26571400 2015 GLP-1 stimulates insulin secretion by PKC-dependent TRPM4 and TRPM5 activation.
26315270 2015 GLP-1 contributes to increases in PGC-1? expression by downregulating miR-23a to reduce apoptosis.
26294429 2015 GLP-1 Cleavage Product Reverses Persistent ROS Generation After Transient Hyperglycemia by Disrupting an ROS-Generating Feedback Loop.
26270730 2015 Chronic Exposure to TNF? Impairs Secretion of Glucagon-Like Peptide-1.
25984632 2015 Glucagon-Like Peptide-1 Regulates Cholecystokinin Production in ?-Cells to Protect From Apoptosis.
More...