Property Summary

NCBI Gene PubMed Count 259
PubMed Score 20357.69
PubTator Score 13052.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Gene RIF (221)

PMID Text
27012036 Abnormal diurnal patterns of PTH are associated with sustained mild hypercalcemia in nondialyzed chronic kidney disease patients.
26997379 Serum secreted i-PTH level might not be predictable by a total mass of parathyroid glands or by their blood supply.
26867053 In this large community-based cohort, PTH levels, overall, were not independently associated with the risk of hypertension. However, we found some evidence that PTH may be associated with hypertension in blacks.
26834008 results suggest that NO-mediated vasorelaxation plays partly a role in the anabolic action of PTH on cortical bone
26662934 Data suggest that effects of PTH on bone remodeling are mediated not only by osteoblasts/osteocytes but also by T-lymphocytes in bone marrow; T-lymphocytes regulate differentiation/life span of stromal cells and their responsiveness to PTH. [REVIEW]
26451492 PTH does not contribute to the occurrence of metabolic components of obesity, but there is a positive correlation between 25(OH)D and HDL-C.
26398210 Elevation of PTH, unlike vitamin D, is independently associated with Chronic Obstructive Pulmonary Disease (COPD) severity, and may be a better biomarker for COPD.
26339419 Study indicates significant association between specific PTH gene promoter region variants and altered levels of 25(OH)D and vitamin D deficiency among specific nationals.
26299086 Suggest that measurement of iPTH may be useful for assessment of mineral bone disorder in patients with chronic kidney disease.
26287968 recombinant human klotho inhibits the expression of 1-OH by PTH both in vitro and in vivo.
26021763 Elevated parathyroid hormone serum concentrations might have a role in colorectal cancer development as indicated by higher rates of adenomas, specifically with dysplasia, in women.
25913526 The identification of PTH and other hormonal resistances implies to look for the genetic disorder supporting the metabolic disorder--{REVIEW}
25891861 A Homozygous [Cys25]PTH(1-84) Mutation That Impairs PTH/PTHrP Receptor Activation Defines a Novel Form of Hypoparathyroidism.
25616948 relative decrease in intact PTH determined 2 hours after total thyroidectomy together with the serum calcium concentration 24 hours after thyroidectomy proved to be useful predictors of sustained hypocalcemia
25562577 In a large community-based sample of elderly, calcium was independently associated with increased arterial stiffness, and PTH independently to intra-arterial peripheral and calculated central blood pressures.
25554227 A detailed characterization of in vitro generated amyloid fibrils from human parathyroid hormone (hPTH(1-84)).
25468653 In a racially/ethnically diverse population without prevalent cardiovascular disease, higher serum PTH concentration was associated with increased left ventricular mass and increased risk of incident heart failure.
25438096 In patients with rheumatoid arthritis, serum levels of DKK1 are significantly increased, correlate with PTH and are associated with increased risk of bone erosions and osteoporosis.
25394432 Conclude that the trends of the median serum levels of PTH and related minerals in the CKD patients in our dialysis patients suggest control and prevention of the vascular calcifications prevalent in the CKD-MBD.
25271253 The objective of this article is to investigate the effect of renin-angiotensin system inhibitors (RASIs) on intact parathyroid hormone (iPTH) levels in continuous ambulatory peritoneal dialysis (CAPD) patients.
25242259 Data suggest serum PTH level is independently associated with bone mineral density (BMD) in vitamin D-sufficient women and vitamin D-insufficient women; no association was found in men; high serum PTH is detrimental on BMD in postmenopausal women.
25241609 Intraoperative PTH monitoring during parathyroidectomy to determine PTH clearance proved to be a feasible marker for adequacy and safety of surgery and "cure".
25218037 salt bridge between Arg-20 on parathyroid hormone (PTH) and Asp-137 on the PTH1 receptor is essential for full affinity.
25140397 In two community-based samples, PTH predicted clinically diagnosed vascular dementia as well as neuroimaging indices of cerebral small vessel disease.
25095827 After aortic valve replacement, the level of PTH is independently associated with left ventricular hypertrophy.
25007156 the iPTH level in ESRD patients carrying VDR BsmI Bb genotype was higher than that in ESRD patients carrying bb genotype in overall populations and in Caucasians
24877630 Constitutive activation of PTH receptor signaling only in osteocytes in transgenic mice is sufficient to increase Rankl expression and bone resorption in vitro, ex vivo and in vivo.
24849536 Data suggest that high serum PTH and calcium are risk factors for hypertension in Japanese subjects; prevalence of hypertension is higher in patients with high PTH levels than in those with low PTH levels in both hypercalcemic/normocalcemic patients.
24779307 Individuals with low to normal intact PTH concentration show higher decrease in intact PTH concentration as compared to individuals with elevated PTH; the rate of PTH degradation is significantly higher in the low to normal PTH group.
24700125 After nearly a decade of follow-up, neither baseline PTH nor 25(OH)D concentrations were associated with progression of carotid arterial stiffness.
24676885 significant decreases in calcaneal bone quality occurred across pregnancy in adolescents, but the magnitude of this loss was attenuated in those with greater prepregnancy weight and weekly increases in PTH.
24626438 PTH was associated to the degree of atherosclerosis and risk of clinically overt atherosclerotic disease.
24487940 Serum PTH level is associated with the number of stenotic coronary arteries.
24429404 we were able to triangulate the relationship between 25(OH)vitamin D3, PTH, and FGF23, showing that vitamin D status critically determines whether FGF23 or PTH becomes elevated first in the context of lower GFR
24397729 Levels of parathyroid hormone in tumor aspirates were accurate for differentiating thyroid neoplasms and parathyroid neoplasms.
24247595 Higher parathyroid hormone levels are associated with poor sleep quality in patients with end-stage renal disease.
24202062 A panel of easily assessable determinants could account for both a substantial proportion of PTH variance and the occurrence of secondary hyperparathyroidism.
24171919 Data suggest nonoxidized, biologically active PTH (n-oxPTH) is useful prognostic biological marker in hemodialysis patients with end-stage renal disease; survival was 1702 days in highest n-oxPTH tertile but only 453 days in lowest n-oxPTH tertile.
24133354 One SNP in the genes encoding prepro-PTH (c.247C > A [rs6256]) was identified in two patients.
23814117 The consistent lack of association of vitamin D and PTH with carotid intima media thickness and plaque suggests that these hormones may influence cardiovascular risk through pathways not reflected by carotid atherosclerosis.
23701502 relationship between 2-hydroxyvitamin D, parathyroid hormone (PTH) and cardiovascular risk in hypertensive patients aged 65 years and over
23635517 High PTH variability is independently associated with lower 25-hydroxyvitamin D concentration and factors of lipid and glucose metabolism in dialysis patients.
23609180 LRP6 in osteoblasts is essential for osteoblastic differentiation during bone remodeling and the anabolic effects of PTH.
23606700 in this selected group of elderly women, we found a strong relationship of increased bone resorption, expressed as BMD, to calcium-regulating hormones PTH and IGF-I.
23596520 Plasma PTH but not 25(OH)D is an independent predictor of the Met S in African and Asian Indians in South Africa.
23585311 PTH(1-34) is able to promote fracture healing.
23543299 Serum PTH was significantly higher in in children with recurrent otitis media than in controls.
23525371 These results identify Wasf2 as a novel target of intermittent PTH administration via the Wnt and phosphoinositide-dependent protein kinase signaling pathways.
23509103 Data suggest that in obese women who are characterized by lower 25-hydroxyvitamin D (25OHD) and higher PTH serum concentrations, the point of near maximal suppression for PTH occurs at lower level of 25OHD compared to general population.
23493435 Data from patients with coexisting primary hyperparathyroidism and active sarcoidosis suggest they have decreased serum PTH/phosphate levels and increased serum ACE (angiotensin-converting enzyme) levels compared to those with inactive sarcoidosis.
23393179 Serum intact PTH in chronic hemodialysis patients is associated significantly and positively with body composition of fat mass and lean mass.
23348879 High parathyroid hormone levels are asssociated with hyperphosphatemia and hyperphosphatasemia.
23286544 Report serum PTH levels during fracture healing in patients with normal/low bone mineral density.
23243213 serum level increased with chronic kidney disease progression in African Americans with hypertensive nephrosclerosis
23228198 Body mass index was strongly associated with plasma 25(OH)D and PTH concentrations.
23190522 Osteoprotegrin (P = 0.001) and intact parathyroid hormone (P = 0.001) levels in hemodialysis patients were higher than in renal transplant recipients.
23168847 Elevated levels of intact PTH most probably does not play a significant role in the dyslipidemia of renal failure.
23165727 These data indicate that ephrinB2/EphB4 signaling within the osteoblast lineage is required for late stages of osteoblast differentiation.
23123579 Increased endogenous PTH levels seems to be associated with a higher bone mineral density increase in patients treated with bisphosphonates for postmenopausal osteoporosis.
23111338 Lower 25(OH)D and higher PTH levels were positively associated with frailty in older men.
23045165 Serum 25(OH)D levels were inversely associated with serum PTH and bone mineral density.
22972177 Vitamin D deficient Saudi children and adults with normal levels of 1,25-dihydroxyvitamin D also had normal circulating calcium and PTH.
22763799 Data suggest that serum PTH can be up-regulated by dietary factors; monophosphates and poly phosphates (commonly used as food additives) in large doses cause elevation of PTH in serum of healthy young women.
22582762 Data show that serum hormone (PTH) provided complementary information for the diagnosis and prognosis of heart failure with preserved ejection fraction (HF-PEF).
22540853 Serum level of vitamin D was inversely related to rheumatoid arthritis activity and this relationship might be independent of PTH secretion or activity.
22456600 Biological variation of bone ALP is less than half that reported for PTH, supporting the use of bone ALP as an alternative marker of bone mineral metabolism in the setting of chronic kidney disease-mineral and bone disorder.
22442276 Older men with higher iPTH levels had approximately a 2-fold greater rate of bone mineral density loss compared with men with lower iPTH levels, irrespective of estimated glomerular filtration rate and 25(OH)D.
22407786 Secular increases in supplemental vitamin D intake influenced both changes in serum 25-hydroxyvitamin D and PTH levels.
22405053 Serum parathyroid levels were found to be independently associated with serum uric acid levels and the frequency of hyperuricemia.
22377250 Higher parathormone levels are associated with poorer health-related quality of life in hemodialysis patients.
22355038 A higher lnPTH might be detrimental to knee cartilage in vivo.
22337915 Data suggest lower serum PTH levels accompanied by lower serum osteocalcin levels are associated with vertebral fractures in postmenopausal women with type 2 diabetes; this suggests that decreased PTH levels indicate deterioration of bone quality.
22190112 These data indicate that the transient RANKL induction by intermittent PTH administration, which is associated with its anabolic action, is changed to a prolonged induction in OSMR-deficient osteoblasts, resulting in bone destruction.
22059355 increased levels in chronic renal failure patients on hemodialysis is associated with lymphopenia and reduction in CD4+ and CD8+ t cell subsets
21968268 Serum OC and NTx levels may be useful markers of serum iPTH levels for evaluating bone turnover in HD patients and may eventually prove useful in the management of patients with CKD-MBD.
21956833 Determinants of 25-hydroxyvitamin D, parathyroid hormone (PTH), and calcitriol across pregnancy in a longitudinal study of 168 pregnant adolescents, were identified.
21939825 Among older adults, parathyroid hormone excess is associated with heart failure.
21932346 Blunted PTH anabolic responses in adult Prg4 mutant mice are associated with altered biomechanical impact secondary to joint failure.
21888960 Oral microemulsion may represent an effective oral delivery system for rhPTH1-34.
21881376 Case Report: Hyperparathyroidism due to eutopic PTH secretion from an ectopic intrathymic parathyroid cyst.
21777186 [review] The parathyroid hormone 1 receptor (PTH1R) is activated by PTH and parathyroid hormone related protein (PTHrP), hormones that mediate mineral ion homeostasis and tissue development, respectively.
21777017 Increased PTH levels, but not low vitamin D, demonstrated close relation to congestive heart failure severity.
21705098 Aortic valve stenosis disease progression is associated with systolic blood pressure and high parathyroid hormone levels.
21656831 In Korean patients with histopathologically proven benign prostatic hyperplasia, high PTH, vitamin D, and calcium levels do not stimulate prostate growth.
21611962 These findings suggest that oxidized lipids mediate hyperlipidemia-induced PTH resistance in bone through modulation of bone resorption.
21590742 FGF-23/Klotho signaling is not essential for the phosphaturic and anabolic functions of PTH.
21576356 Data show that calmodulin negatively modulates TRPV5 activity, which is reversed by parathyroid hormone-mediated channel phosphorylation.
21465527 MEF is involved in PTH suppression of osteoblasts through activating the MKK4/JNK1 pathway and subsequently up-regulating Mab21l1 expression.
21426456 Diabetic patients had a significant increase in PO4 and parathormone levels along with a significant decrease in Ca, IGF-1, and 25(OH)vitamin D serum levels.
21389978 Increased FGF23 is a common manifestation of chronic kidney disease that develops earlier than increased phosphate or parathyroid hormone.
21389278 PTH directly and rapidly stimulated apical HCO3 secretion through cystic fibrosis transmembrane conductance regulator in PKA-and PI3K-dependent manner, which was a novel noncalciotropic, ion regulatory action of PTH in the intestinal epithelium.
21383630 analysis of parathyroid hormone and mobilization of circulating bone marrow-derived cells in uremic patients
21306649 Results indicate that for women PTH is a plausible mediator in the association between metabolic syndrome and a range of explanatory variables, including vit D, magnesium and phosphate.
21248778 Increasing parathyroid hormone levels were associated with higher blood pressure in older Chinese men.
21203493 Thymic associated parathyroid hormone has no endocrine function but with immunological function.
21178378 In this observational French cohort, a very low parathyroid hormone (PTH) level is observed in 10% of prevalent hemodialysis patients and is associated with poor survival rates.
21082232 Observational study of gene-disease association. (HuGE Navigator)
20872272 Study yields important insights into the relations between vitamin D status and PTH levels following renal transplantation in children.
20820131 Data show that increased serum parathyroid hormone is independently associated with neuroendocrine activation (NT-pro-BNP, adiponectin) and endothelial dysfunction in elderly men with chronic heart failure.
20809279 Observational study of gene-disease association. (HuGE Navigator)
20808842 PTH receptor 1 signaling in T cells plays an essential role in parathyroid hormone induced bone loss
20654748 Observational study of gene-disease association. (HuGE Navigator)
20654714 Periostin is a PTH regulated extracellular matrix protein, partly co-localizing with collagen 1a1.
20641034 A chromosomal rearrangement whose novel features provide clues to locating elusive cis-regulatory elements in the PTH gene, is described.
20639672 Review suggests monitoring PTH levels from the early stages of chronic kidney disease, thereby preventing any mineral metabolism disorders that may trigger excessive synthesis and secretion of PTH.
20634326 Patients with high serum FGF-23 level and/or low PTH level at the time of transplantation are at risk for increased bone mineral density loss during the first post-transplant year.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20601288 Data show that parathyroid hormone levels were highly conditioned by those of 25OHD in subjects with 25OHD values lower than 16.35 ng/mL and by those of ionized Ca only for higher 25OHD concentration.
20578167 A PTHR isoform harboring an in-frame 42-bp deletion of exon 14 (Delta e14-PTHR) that encodes transmembrane domain 7, is described.
20558332 These results indicate that GCMB and vitamin D receptor are involved in the positive and negative regulation of parathyroid hormone gene expression, respectively.
20498246 The uncertainty of PTH estimation in an individual significantly undermines its value as a tool in the management of chronic kidney disease-mineral bone disorder using current management approaches.
20471507 Absence of COX-2 increased sensitivity to PTH.
20452474 The negative relationship between vitamin D and PTH is modulated by age but not gender.
20349051 Polymorphisms in the PTH gene are associated with differences in aspects of femoral neck geometry in elderly women.
20349051 Observational study of gene-disease association. (HuGE Navigator)
20156921 Our findings suggest that serum sclerostin levels are regulated by both estrogens and parathyroid hormone in postmenopausal women
20097749 HDAC4 represses matrix metalloproteinase-13 transcription in osteoblastic cells, and parathyroid hormone controls this repression
20056760 Report results of a randomized trial of cholecalciferol versus doxercalciferol for lowering parathyroid hormone in vitamin D deficient chronic kidney disease.
20005908 Data suggest that in Caco-2 cells, PP2A and the cAMP pathway act in concert to inactivate the AKT survival pathway in PTH-induced intestinal cell apoptosis.
19965540 The use of phosphate binders in chronic kidney disease patients with normal serum phosphate levels was associated with improved control of secondary hyperparathyroidism without corresponding changes in serum phosphate levels.
19918796 Report dual role of parathyroid hormone in endothelial progenitor cells and marrow stromal mesenchymal stem cells.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19874204 parathyroid hormone (PTH) and interleukin 21 receptor (IL21R), achieved consistent association results for bone mineral density in both discovery and replication samples.
19874204 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19809994 Asymmetric dimethylarginine levels could be influenced by the severity of hyperparathyroidism and contribute to cardiovascular death linked to parathyroid hormone of hemodialysis patients.
19696213 Simultaneous control of PTH and CaxP Is sustained over three years of treatment with cinacalcet HCl.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19690432 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19672814 PTH stimulated BMP-2 mRNA expression via the mevalonate pathway and ROK in osteoblastic MC3T3-E1 cells
19625176 Observational study of gene-disease association. (HuGE Navigator)
19570881 Report human PTH gene regulation in vivo using transgenic mice.
19565936 Accelerated bone mineralization is reflected by high levels of serum Parathyroid hormone during puberty; boys with constitutional delay of growth had prepubertal levels
19557980 The association of the PTH gene variant has been the only positive association studied in patients with aortic stenosis in a large population.
19557980 Observational study of gene-disease association. (HuGE Navigator)
19539290 Parathyroid hormone levels were not associated with carotid atherosclerosis.
19524129 PTH treatment of differentiated 3T3-L1 adipocytes suppresses insulin-stimulated glucose uptake and insulin signaling via cAMP pathway.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19397786 The expression of the calcium receptor is sufficient to confer the regulation of parathyroid hormone gene expression to these heterologous cells
19386515 Serum and saliva PTH and salivary calcium levels are significantly higher in menopausal women suffering from oral dryness. It also appears that oral dryness severity correlates with serum and stimulated levels of whole salivary PTH and salivary calcium.
19384851 Parathyroid hormone stimulation of osteoblastic cells can regulate c-Raf phosphorylation through a cAMP-mediated pathway in the rapid dephosphorylation of ERK.
19370057 PTH promotes apoptosis in Caco-2 intestinal cells.
19250270 Data postulate that increased levels of PTH in primary hyperparathyroidism may be associated with the increased cardiovascular morbidity and mortality.
19230880 Elevated levels of phosphorus and parathyroid hormone in women with polycystic ovary syndrome, at least in part, through their effects on insulin levels and insulin resistance, are involved in pathogenesis of the syndrome.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19057839 A novel mutation in the GATA3 gene in a patient with PTH-deficient hypoparathyroidism.
19019998 Study indicates that elevated iPTH levels are common among patients with moderate chronic kidney disease.
18945829 Parathyroid hormone decreases endothelial osteoprotegerin secretion due to possible roles of protein kinase A and C.
18821330 The present study examines the possible phenotype-haplotype specificity of the associations in osteoprotegerin and parathyroid hormone gene regions.
18798227 PTH induction of apoptosis is mediated by translocation of mitochondria to the perinuclear region, dephosphorylation of Akt, dephosphorylation of Bad and its movement to the mitochondria, release of cytochrome c and Smac/Diablo, activating casp3.
18782355 PTH level can be measured using second and third generation assays in some PHP patients, and a specific surgical protocol for possible parathyroid carcinoma could be discussed in patients with a high third generation/second generation PTH ratio.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18649177 Regulaztes expression of connexin 43.
18627264 The data raise the possibility that PTH or PTHrP might regulate ephrinB2 to act in a paracrine or autocrine manner on EphB4 or EphB2 in the osteoblast, contributing as a local event to the anabolic action of PTH or PTHrP.
18583400 These data indicate a novel role for KSRP in parathyroid hormone gene expression.
18551993 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18539556 These data suggest that in female C57BL/6 mice, under some but not all circumstances, mechanical loading exerts an osteogenic response with iPTH (1-34) in trabecular and cortical bone.
18499553 Osteonectin levels may play a role in modulating the balance of bone formation and resorption in response to PTH.
18348699 These studies show that exogenous PTH administered continuously resorbs bone without raising endogenous 1,25(OH)(2)D.
18285546 Observational study of gene-disease association. (HuGE Navigator)
18283239 some correlations between PTH and its fractions and bone mineral density and bone turnover were seen in women with hyperprolactinemia
18280230 in a cohort of elderly Swedish women, polymorphisms in PTH may contribute to the risk of fracture through mechanisms that are independent of bone mineral density
18280230 Observational study of gene-disease association. (HuGE Navigator)
18279669 we present evidence for a novel pathogenic role of PTH 1-84 in promoting hCMV immediate-early gene transcription.
18166826 Data show that serum PTH and FGF23 are associated in vivo, supporting recent findings that FGF23 directly regulates PTH expression in vitro.
18165223 IL-18 is regulated by parathyroid hormone and is required for its bone anabolic actions
18061978 Elevated serum concentration of PTH mid-fragments containing the 44-68 region could explain the joint disorders associated with idiopathic calcium pyrophosphate dihydrate deposition disease
18056632 findings demonstrate that the expressed signal sequence mutant hormone is trapped intracellularly, predominantly in the endoplasmic reticulum; ER retention was found to be toxic for the cells, which underwent apoptosis
17990294 crosstalk between PTH/cAMP signaling and canonical Wnt signaling using the human osteoblastic cell line Saos-2
17976926 Present an atypical case of leukemic transformation in myelofibrosis associated with diffuse osteolytic lesions and extremely elevated TNF-alpha and lactate dehydrogenase (LDH). Parathormone was not disturbed.
17823083 Raloxifene treatment reduces bone turnover biochemical markers, parathyroid hormone and induces 25-OH vitamin D in postmenopausal women.
17351276 An increased risk of metabolic syndrome with elevated PTH levels in older men.
17121534 based on the absence of identifiable DNA sequence alterations in parathyroid disorders, it is unlikely that mutation of the PTH 3'-UTR contributes frequently to their pathogenesis
16762954 Observational study of genotype prevalence. (HuGE Navigator)
16682833 blood pressure and serum parathyroid hormone (PTH) are associated.
16677544 Observational study of gene-disease association. (HuGE Navigator)
16475791 Mid-region of PTH-(1-34) has a role in fixing, by extensive contacts with receptor, entry of N-terminal helix of the hormone into a heptahelical bundle between TM-1 & TM-2. This anchorage would orient the amino terminus into position to activate receptor.
16412323 Observational study of gene-disease association. (HuGE Navigator)
16362385 Observational study of gene-disease association. (HuGE Navigator)
16272640 Observational study of gene-disease association. (HuGE Navigator)
16117875 Observational study of gene-disease association. (HuGE Navigator)
16105030 non-(1-84) PTH fragments are composed of a family of fragments which may be generated by specific or progressive cleavage at the N region
16081646 Suppression of Sost by PTH represents a novel mechanism for hormonal control of osteoblastogenesis mediated by osteocytes.
15962290 a possible role for the Wnt signaling pathway in PTH actions in bone
15917161 Observational study of gene-disease association. (HuGE Navigator)
15890770 Transactivation of the PTH promoters is observed by Sp proteins and the NF-Y complex.
15826940 data thus provide direct evidence for important roles of the C-terminal domain of PTH in determining high affinity binding and activation of the P1R receptor
15824859 alternative cis-acting protein-binding elements may determine the regulation of PTH mRNA stability in response to changes in serum calcium and phosphate
15808916 Carboxy-terminal fragment of PTH was equivalent to the intact PTH molecule in stimulating [3H]thymidine incorporation in HUVEC.
15769857 PTH is a potent down-regulator of vitamin D receptor expression.
15707954 These results indicate that 1,25(OH)2D3 may affect transcription of the human PTH gene both by competitive binding of VDR and NF-Y, and by modulating transcriptional activity of NF-Y.
15639837 Observational study of gene-disease association. (HuGE Navigator)
15515479 Inverse correlation between intact serum parathyroid homone with percent of left ventricular ejection fraction in non-diabetic hemodialysis patients was observed.
15514034 calcineurin regulates AUF1 posttranslationally in vitro and PTH gene expression in vivo but still allows its physiological regulation by calcium and phosphate
15504937 PTH attenuates the stress-induced JNK signaling pathway in osteoblasts via induction of MKP-1 synthesis but inhibits the p42/44 MAPK pathway mainly via transcription-independent mechanisms.
15472173 in patients with sporadic idiopathic hypoparathyroidism, neither the clinical manifestations nor the biochemical indexes are related to the occurrence of mutations or single nucleotide polymorphisms in the PTH gene
15297458 there is a proximal NF-Y-binding site in the hPTH promoter, which has a role in enhancing transcription
15240611 These data support the hypothesis that hPTH (1-34) initially stimulates osteoblast maturation and function, which in turn leads to osteoclast activation and a gradual rebalancing of bone formation and resorption.
15227728 11-residue short oligopeptide analogues of PTH tend to form an alpha-helical structure and the different activities of those analogues could be associated with residue specificity rather than the secondary conformational structure.
15186723 results revealed a novel potent effect of PTH and vitamin D(3) plus BMPs in inducing bone development by human mesenchymal stem cells
15070925 The rise in serum PTH appeared to start when serum 25(OH)D fell less than 80 nmol/liter.
15070914 Serum PTH is a predictor of time to first fall in the frail elderly independent of vitamin D status and measures of general health.
15035617 Studies suggest that an alpha-helix is the preferred conformation for the residue 15-20 region of PTH and that residues 10-14 are also required for full affinity and potency of the hormone.
14969386 role in programing skeletal development in utero
14730973 High-resolution structures clearly illustrate the structural differences between linear and cyclic PTH(1-14) fragments, supporting the hypothesis that an alpha-helix is the preferred bioactive conformation of the N-terminal fragment of PTH.
14506618 estrogen receptor alpha Px haplotype and collagen IA1 s allele may be involved in causing the phenotypic expression of higher circulating levels of parathyroid hormone and higher bone turnover, which may lead to bone loss
12947048 1-21 region of PTH binds to the extracellular face of the type 1 PTH receptorPTHRP domain as an alpha-helix.
12914574 Observational study of genotype prevalence. (HuGE Navigator)
12905817 Observational study of gene-disease association. (HuGE Navigator)
12893275 Lack of evidence for the parathyroid hormone gene as a quantitative trait locus underlying the bone phenotypic variation in the Chinese.
12403624 Residues 15-20, particularly residue 19, of PTH contribute to the receptor interaction process via a mechanism that involves the N-terminal portion of the ligand and the juxtamembrane region of the receptor.
12369776 Review. The effects of intermittent and continuous PTH exposure on periosteal bone expansion & osteoblast apoptosis are reviewed.
12364326 demonstration that PTH directly stimulates RANKL expression via a PKA-CREB pathway
12207101 REVIEW: role in coronary heart disease in uremic patients
12195069 Observational study of gene-disease association. (HuGE Navigator)
12046039 Observational study of gene-disease association. (HuGE Navigator)
11984699 Observational study of gene-disease association. (HuGE Navigator)
11956184 New signaling pathway for parathyroid hormone and cyclic AMP action on extracellular-regulated kinase and cell proliferation in bone cells
11918225 Observational study of gene-disease association. (HuGE Navigator)
11918225 data do not support the PTH gene as a quantitative trait locus(QTL)underlying hip or spine bone mineral density variation
11814621 We report that PTH induced the appearance of voltage sensitive calcium channels. Furthermore, PTH increased ceramide but not diacylglycerol content.
11467957 The presence of an evolutionarily conserved arginine residue on the hydrophobic face of parathyroid hormone's amphiphilic alpha-helix strongly affects PTH receptor binding and adenylyl cyclase-stimulating activities.

AA Sequence

MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGA      1 - 70
PLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ                              71 - 115
//

Text Mined References (261)

PMID Year Title
27012036 2016 Abnormal Diurnal Patterns of Parathyroid Hormone are Associated with Sustained Mild Hypercalcemia in Non-Dialyzed Chronic Kidney Disease.
26997379 2016 The relationship between total mass and blood supply of parathyroid glands and their secretion of parathyroid hormone in hemodialysis patients with secondary hyperparathyroidism.
26867053 2016 Parathyroid hormone and the risk of incident hypertension: the Atherosclerosis Risk in Communities study.
26834008 2016 The anabolic action of intermittent parathyroid hormone on cortical bone depends partly on its ability to induce nitric oxide-mediated vasorelaxation in BALB/c mice.
26662934 2016 T cells, osteoblasts, and osteocytes: interacting lineages key for the bone anabolic and catabolic activities of parathyroid hormone.
26451492 2015 Relationship Between Parathormone and Obesity-Linked Disorders.
26398210 2015 Parathyroid Hormone as a Novel Biomarker for Chronic Obstructive Pulmonary Disease: Korean National Health and Nutrition Examination Survey.
26339419 2015 Association between promoter region genetic variants of PTH SNPs and serum 25(OH)-vitamin D level.
26303600 2015 PTH receptor-1 signalling-mechanistic insights and therapeutic prospects.
26299086 2015 Alkaline Phosphatase, iPTH and Bone Turnover Markers in Chinese Advanced Chronic Kidney Disease Patients.
26287968 2016 Xeno-Klotho Inhibits Parathyroid Hormone Signaling.
26021763 2015 Parathyroid Hormone is Related to Dysplasia and a Higher Rate of Distal Colorectal Adenoma in Women but Not Men.
25913526 2015 Multiple hormonal resistances: Diagnosis, evaluation and therapy.
25891861 2015 A Homozygous [Cys25]PTH(1-84) Mutation That Impairs PTH/PTHrP Receptor Activation Defines a Novel Form of Hypoparathyroidism.
25616948 2015 Hypocalcaemia after total thyroidectomy: could intact parathyroid hormone be a predictive factor for transient postoperative hypocalcemia?
25562577 2015 Parathyroid hormone and calcium are independently associated with subclinical vascular disease in a community-based cohort.
25554227 2015 Structural characterization of amyloid fibrils from the human parathyroid hormone.
25468653 2014 Serum parathyroid hormone and 25-hydroxyvitamin D concentrations and risk of incident heart failure: the Multi-Ethnic Study of Atherosclerosis.
25438096 In patients with rheumatoid arthritis, Dickkopf-1 serum levels are correlated with parathyroid hormone, bone erosions and bone mineral density.
25394432 2014 Trends of elevated parathormone serum titers in hemodialysis patients on intensive therapy for bone disease: a multicenter study.
25271253 2015 The effect of renin-angiotensin system inhibitors on intact parathyroid hormone levels in peritoneal dialysis patients.
25242259 2014 Effect of high parathyroid hormone level on bone mineral density in a vitamin D-sufficient population: Korea National Health and Nutrition Examination Survey 2008-2010.
25241609 2014 Intraoperative parathyroid hormone monitoring corroborates the success of parathyroidectomy in children.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25218037 2014 A salt bridge between Arg-20 on parathyroid hormone (PTH) and Asp-137 on the PTH1 receptor is essential for full affinity.
25140397 2014 Plasma parathyroid hormone is associated with vascular dementia and cerebral hyperintensities in two community-based cohorts.
25095827 2014 Parathyroid hormone is associated with the LV mass after aortic valve replacement.
25007156 2015 Association of vitamin D receptor BsmI (rs1544410) gene polymorphism with the intact parathyroid hormone (iPTH) level among patients with end-stage renal disease.
24877630 2014 Parathyroid hormone receptor signaling induces bone resorption in the adult skeleton by directly regulating the RANKL gene in osteocytes.
24849536 2014 High serum parathyroid hormone and calcium are risk factors for hypertension in Japanese patients.
24779307 2014 Changes in plasma intact parathyroid hormone levels following 24-hour incubation at room temperature as determined by Roche electrochemiluminescence PTH immunoassay.
24700125 2014 25-hydroxyvitamin D and parathyroid hormone levels do not predict changes in carotid arterial stiffness: the Multi-Ethnic Study of Atherosclerosis.
24676885 2014 Reductions in heel bone quality across gestation are attenuated in pregnant adolescents with higher prepregnancy weight and greater increases in PTH across gestation.
24626438 2014 Plasma-parathyroid hormone is associated with subclinical and clinical atherosclerotic disease in 2 community-based cohorts.
24487940 2014 The association of serum parathyroid hormone and severity of coronary artery diseases.
24429404 2014 The impact of vitamin D status on the relative increase in fibroblast growth factor 23 and parathyroid hormone in chronic kidney disease.
24397729 2013 Parathyroid hormone determination in ultrasound-guided fine needle aspirates allows the differentiation between thyroid and parathyroid lesions: our experience and review of the literature.
24247595 2013 Uremic restless legs syndrome (RLS) and sleep quality in patients with end-stage renal disease on hemodialysis: potential role of homocysteine and parathyroid hormone.
24202062 2014 Parathyroid-hormone variance is only marginally explained by a panel of determinants: a cross-sectional study of 909 hip-fracture patients.
24171919 2013 Nonoxidized, biologically active parathyroid hormone determines mortality in hemodialysis patients.
24133354 2013 Genetic and clinical characteristics of korean patients with isolated hypoparathyroidism: from the Korean hypopara registry study.
23814117 2013 25-Hydroxyvitamin D and parathyroid hormone are not associated with carotid intima-media thickness or plaque in the multi-ethnic study of atherosclerosis.
23701502 2014 The relationship between vitamin D and PTH levels and cardiovascular risk in the elderly hypertensives.
23635517 2013 Determinants of fibroblast growth factor-23 and parathyroid hormone variability in dialysis patients.
23609180 2013 Disruption of LRP6 in osteoblasts blunts the bone anabolic activity of PTH.
23606700 Circulating PTH, Vitamin D and IGF-I levels in relation to bone mineral density in elderly women.
23596520 2013 The association of 25 hydroxyvitamin D and parathyroid hormone with metabolic syndrome in two ethnic groups in South Africa.
23585311 2013 The effect of PTH(1-34) on fracture healing during different loading conditions.
23543299 2014 Serum vitamin D levels in children with recurrent otitis media.
23525371 2013 Wasf2: a novel target of intermittent parathyroid hormone administration.
23509103 2013 The effect of obesity on the relationship between serum parathyroid hormone and 25-hydroxyvitamin D in women.
23493435 2013 Coexisting primary hyperparathyroidism and sarcoidosis cause increased angiotensin-converting enzyme and decreased parathyroid hormone and phosphate levels.
23393179 2013 Significant positive association between parathyroid hormone and fat mass and lean mass in chronic hemodialysis patients.
23348879 2013 Correlates of parathyroid hormone concentration in hemodialysis patients.
23286544 2013 Time course of 25(OH)D3 vitamin D3 as well as PTH (parathyroid hormone) during fracture healing of patients with normal and low bone mineral density (BMD).
23243213 2013 Mineral metabolites and CKD progression in African Americans.
23228198 2012 Plasma vitamin D and parathormone are associated with obesity and atherogenic dyslipidemia: a cross-sectional study.
23190522 2012 Serum receptor activator of nuclear factor-? B ligand, osteoprotegrin, and intact parathyroid hormone in hemodialysis and renal transplant patients.
23168847 2012 Relationship between serum parathyroid hormone levels and lipid profile in non-diabetic hemodialysis patients.
23165727 2013 EphrinB2/EphB4 inhibition in the osteoblast lineage modifies the anabolic response to parathyroid hormone.
23123579 2012 Relationship between increased endogenous parathormone levels and bone density in postmenopausal women treated with bisphosphonates.
23111338 2013 The association of frailty with serum 25-hydroxyvitamin D and parathyroid hormone levels in older European men.
23045165 2013 Impact of calcium and vitamin D insufficiencies on serum parathyroid hormone and bone mineral density: analysis of the fourth and fifth Korea National Health and Nutrition Examination Survey (KNHANES IV-3, 2009 and KNHANES V-1, 2010).
22972177 2013 Normal circulating PTH in Saudi healthy individuals with hypovitaminosis D.
22763799 2013 Mono- and polyphosphates have similar effects on calcium and phosphorus metabolism in healthy young women.
22582762 2012 Usefulness of parathyroid hormone as a predictor of heart failure with preserved ejection fraction.
22540853 2012 Relationship between disease activity and serum levels of vitamin D and parathyroid hormone in rheumatoid arthritis.
22456600 2012 Bone-specific alkaline phosphatase concentrations are less variable than those of parathyroid hormone in stable hemodialysis patients.
22442276 2012 Association of intact parathyroid hormone levels with subsequent hip BMD loss: the Osteoporotic Fractures in Men (MrOS) Study.
22407786 2012 Temporal trends and determinants of longitudinal change in 25-hydroxyvitamin D and parathyroid hormone levels.
22405053 2012 The independent association between parathyroid hormone levels and hyperuricemia: a national population study.
22377250 2012 A study of the association of higher parathormone levels with health-related quality of life in hemodialysis patients.
22355038 2012 Endogenous parathyroid hormone is associated with reduced cartilage volume in vivo in a population-based sample of adult women.
22337915 2012 Decreased PTH levels accompanied by low bone formation are associated with vertebral fractures in postmenopausal women with type 2 diabetes.
22190112 2012 Sustained RANKL response to parathyroid hormone in oncostatin M receptor-deficient osteoblasts converts anabolic treatment to a catabolic effect in vivo.
22059355 2009 Immunomodulatory effects of secondary hyperparathyroidism on circulating CD4+ and CD8+ T-lymphocytes in chronic renal failure patients.
21968268 2011 Correlation of new bone metabolic markers with conventional biomarkers in hemodialysis patients.
21956833 2012 Vitamin D insufficiency is prevalent and vitamin D is inversely associated with parathyroid hormone and calcitriol in pregnant adolescents.
21939825 2011 Vitamin D, parathyroid hormone, and cardiovascular events among older adults.
21932346 2012 Proteoglycan 4: a dynamic regulator of skeletogenesis and parathyroid hormone skeletal anabolism.
21888960 2011 Preliminary evaluation of a novel oral delivery system for rhPTH1-34: in vitro and in vivo.
21881376 2011 Hyperparathyroidism due to eutopic PTH secretion from an ectopic intrathymic parathyroid cyst.
21777186 2012 The parathyroid hormone receptorsome and the potential for therapeutic intervention.
21777017 2011 Parathyroid hormone response to vitamin D insufficiency in elderly males with chronic heart failure.
21705098 2013 Parathyroid hormone and systolic blood pressure accelerate the progression of aortic valve stenosis in chronic hemodialysis patients.
21656831 2011 Parathyroid hormone is not involved in prostate growth in patients with benign prostatic hyperplasia.
21611962 2011 Hyperlipidemia induces resistance to PTH bone anabolism in mice via oxidized lipids.
21590742 2011 FGF-23/Klotho signaling is not essential for the phosphaturic and anabolic functions of PTH.
21576356 2011 Molecular mechanisms of calmodulin action on TRPV5 and modulation by parathyroid hormone.
21465527 2011 PTH regulates myleoid ELF-1-like factor (MEF)-induced MAB-21-like-1 (MAB21L1) expression through the JNK1 pathway.
21426456 2011 Parathormone--25(OH)-vitamin D axis and bone status in children and adolescents with type 1 diabetes mellitus.
21389978 2011 Fibroblast growth factor 23 is elevated before parathyroid hormone and phosphate in chronic kidney disease.
21389278 2011 Parathyroid hormone (PTH) rapidly enhances CFTR-mediated HCO?? secretion in intestinal epithelium-like Caco-2 monolayer: a novel ion regulatory action of PTH.
21383630 2011 Parathyroid hormone and mobilization of circulating bone marrow-derived cells in uremic patients.
21306649 2011 Parathyroid hormone is a plausible mediator for the metabolic syndrome in the morbidly obese: a cross-sectional study.
21248778 2012 Serum 25-hydroxyvitamin D and parathyroid hormone levels in relation to blood pressure in a cross-sectional study in older Chinese men.
21203493 2010 Thymus-associated parathyroid hormone has two cellular origins with distinct endocrine and immunological functions.
21178378 2011 Association between very low PTH levels and poor survival rates in haemodialysis patients: results from the French ARNOS cohort.
21082232 2011 Influence of gene variants related to calcium homeostasis on biochemical parameters of women with polycystic ovary syndrome.
21076856 2011 Stimulation of glucose transport in osteoblastic cells by parathyroid hormone and insulin-like growth factor I.
20872272 2010 Vitamin D deficiency and parathyroid hormone levels following renal transplantation in children.
20820131 2011 Association of increased parathyroid hormone with neuroendocrine activation and endothelial dysfunction in elderly men with heart failure.
20809279 2010 Comprehensive association analysis of nine candidate genes with serum 25-hydroxy vitamin D levels among healthy Caucasian subjects.
20808842 2010 Disruption of PTH receptor 1 in T cells protects against PTH-induced bone loss.
20654748 2010 High-density polymorphisms analysis of 23 candidate genes for association with bone mineral density.
20654714 2010 Periostin is a collagen associated bone matrix protein regulated by parathyroid hormone.
20641034 2010 Tissue-specific regulatory regions of the PTH gene localized by novel chromosome 11 rearrangement breakpoints in a parathyroid adenoma.
20639672 2010 CKD patients: the dilemma of serum PTH levels.
20634326 2010 Fibroblast growth factor-23 and parathyroid hormone are associated with post-transplant bone mineral density loss.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20601288 2010 Regulation of PTH secretion by 25-hydroxyvitamin D and ionized calcium depends on vitamin D status: a study in a large cohort of healthy subjects.
20578167 2011 A naturally occurring isoform inhibits parathyroid hormone receptor trafficking and signaling.
20558332 2010 Involvement of GCMB in the transcriptional regulation of the human parathyroid hormone gene in a parathyroid-derived cell line PT-r: effects of calcium and 1,25(OH)2D3.
20498246 2010 Variability of parathyroid hormone and other markers of bone mineral metabolism in patients receiving hemodialysis.
20471507 2010 Basal bone phenotype and increased anabolic responses to intermittent parathyroid hormone in healthy male COX-2 knockout mice.
20452474 2010 Age but not gender modulates the relationship between PTH and vitamin D.
20349051 2010 Variation in the PTH gene, hip fracture, and femoral neck geometry in elderly women.
20156921 2010 Serum sclerostin levels negatively correlate with parathyroid hormone levels and free estrogen index in postmenopausal women.
20097749 2010 HDAC4 represses matrix metalloproteinase-13 transcription in osteoblastic cells, and parathyroid hormone controls this repression.
20056760 2010 A randomized trial of cholecalciferol versus doxercalciferol for lowering parathyroid hormone in chronic kidney disease.
20005908 2010 PTH inactivates the AKT survival pathway in the colonic cell line Caco-2.
19965540 2010 Early control of PTH and FGF23 in normophosphatemic CKD patients: a new target in CKD-MBD therapy?
19918796 2010 Dual role of parathyroid hormone in endothelial progenitor cells and marrow stromal mesenchymal stem cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19874204 2010 IL21R and PTH may underlie variation of femoral neck bone mineral density as revealed by a genome-wide association study.
19809994 Asymmetric dimethylarginine, vascular calcifications and parathyroid hormone serum levels in hemodialysis patients.
19723499 2009 T lymphocytes amplify the anabolic activity of parathyroid hormone through Wnt10b signaling.
19696213 2009 Simultaneous control of PTH and CaxP Is sustained over three years of treatment with cinacalcet HCl.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19690432 2009 Associations of vitamin D receptor, calcium-sensing receptor and parathyroid hormone gene polymorphisms with calcium homeostasis and peripheral bone density in adult Finns.
19674967 2009 Structural basis for parathyroid hormone-related protein binding to the parathyroid hormone receptor and design of conformation-selective peptides.
19672814 2009 Parathyroid hormone upregulates BMP-2 mRNA expression through mevalonate kinase and Rho kinase inhibition in osteoblastic MC3T3-E1 cells.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19570881 2009 Human PTH gene regulation in vivo using transgenic mice.
19565936 2008 Association between bone turnover markers and bone mineral density in puberty and constitutional delay of growth and puberty.
19557980 2009 Parathyroid hormone gene variant and calcific aortic stenosis.
19539290 2009 Serum vitamin D, parathyroid hormone levels, and carotid atherosclerosis.
19524129 2009 Parathyroid hormone suppresses insulin signaling in adipocytes.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19397786 2009 The calcium-sensing receptor regulates parathyroid hormone gene expression in transfected HEK293 cells.
19386515 2009 Serum and stimulated whole saliva parathyroid hormone in menopausal women with oral dry feeling.
19384851 2009 Parathyroid hormone inhibits phosphorylation of mitogen-activated protein kinase (MAPK) ERK1/2 through inhibition of c-Raf and activation of MKP-1 in osteoblastic cells.
19370057 2009 Pro-apoptotic effects of parathyroid hormone in intestinal cells.
19250270 2009 Correlation between plasma calcium, parathyroid hormone (PTH) and the metabolic syndrome (MetS) in a community-based cohort of men and women.
19230880 2010 Calciotropic hormones, insulin resistance, and the polycystic ovary syndrome.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19057839 2009 A novel mutation in the GATA3 gene of a Japanese patient with PTH-deficient hypoparathyroidism.
19019998 2009 Association of serum intact parathyroid hormone with lower estimated glomerular filtration rate.
18945829 2009 Parathyroid hormone decreases endothelial osteoprotegerin secretion: role of protein kinase A and C.
18821330 Anthropometric and bone-related biochemical factors are associated with different haplotypes of ANKH locus.
18798227 2008 The early phase of programmed cell death in Caco-2 intestinal cells exposed to PTH.
18782355 2009 High third generation/second generation PTH ratio in a patient with parathyroid carcinoma: clinical utility of third generation/second generation PTH ratio in patients with primary hyperparathyroidism.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18649177 2008 Role of gap junction, hemichannels, and connexin 43 in mineralizing in response to intermittent and continuous application of parathyroid hormone.
18627264 2008 EphrinB2 regulation by PTH and PTHrP revealed by molecular profiling in differentiating osteoblasts.
18583400 2008 The mRNA decay promoting factor K-homology splicing regulator protein post-transcriptionally determines parathyroid hormone mRNA levels.
18551993 2008 SNP combinations in chromosome-wide genes are associated with bone mineral density in Taiwanese women.
18539556 2008 Mechanical loading enhances the anabolic effects of intermittent parathyroid hormone (1-34) on trabecular and cortical bone in mice.
18499553 2008 Accentuated osteoclastic response to parathyroid hormone undermines bone mass acquisition in osteonectin-null mice.
18375760 2008 Molecular recognition of parathyroid hormone by its G protein-coupled receptor.
18348699 2008 Exogenous PTH and endogenous 1,25-dihydroxyvitamin D are complementary in inducing an anabolic effect on bone.
18285546 2008 A PAI-1 (SERPINE1) polymorphism predicts osteonecrosis in children with acute lymphoblastic leukemia: a report from the Children's Oncology Group.
18283239 2008 The role of cyclase activating (CAP) and cyclase inhibiting (CIP) parathormone fractions in the assessment of bone metabolism disturbances in women with hyperprolactinemia of various origin.
18280230 2008 Genetic variation in the PTH pathway and bone phenotypes in elderly women: evaluation of PTH, PTHLH, PTHR1 and PTHR2 genes.
18279669 2008 PTH regulation of the human cytomegalovirus immediate-early gene promoter.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
18166826 2008 Fibroblast growth factor-23 is associated with parathyroid hormone and renal function in a population-based cohort of elderly men.
18165223 2008 Interleukin-18 is regulated by parathyroid hormone and is required for its bone anabolic actions.
18061978 2008 Elevated parathyroid hormone 44-68 in idiopathic calcium pyrophosphate dihydrate crystal deposition disease. Role of menopause and iron metabolism?
18056632 2007 Signal sequence mutation in autosomal dominant form of hypoparathyroidism induces apoptosis that is corrected by a chemical chaperone.
17990294 2008 PTH/cAMP/PKA signaling facilitates canonical Wnt signaling via inactivation of glycogen synthase kinase-3beta in osteoblastic Saos-2 cells.
17976926 2008 Elevated TNF-alpha and LDH without parathormone disturbance is associated with diffuse osteolytic lesions in leukemic transformation of myelofibrosis.
17823083 2007 Influence of the selective oestrogen receptor modulator (raloxifene hydrochloride) on IL-6, TNF-alpha, TGF-beta1 and bone turnover markers in the treatment of postmenopausal osteoporosis.
17696759 2007 Control of the SOST bone enhancer by PTH using MEF2 transcription factors.
17351276 2007 Vitamin D, parathyroid hormone levels, and the prevalence of metabolic syndrome in community-dwelling older adults.
17121534 2006 Mutational analysis of the PTH 3'-untranslated region in parathyroid disorders.
16762954 2006 Prevalence and functional significance of 25-hydroxyvitamin D deficiency and vitamin D receptor gene polymorphisms in Asian Indians.
16682833 2006 The relationship between blood pressure and serum parathyroid hormone with special reference to urinary calcium excretion: the Tromsø study.
16677544 2006 [Relationship between polymorphism of parathyroid hormone and bone mineral density and relevant biochemical indicators in women].
16475791 2006 The mid-region of parathyroid hormone (1-34) serves as a functional docking domain in receptor activation.
16412323 2005 [Study of the impact of candidate genes on bone mineral density in postmenopausal women].
16362385 2006 Distinct association of gene polymorphisms of estrogen receptor and vitamin D receptor with lumbar spondylosis in post-menopausal women.
16272640 2005 [Effects of parathyroid hormone gene polymorphism on cardiovascular mortality].
16117875 2005 Contribution of genotype and ethnicity to bone mineral density variation in Caucasians and Chinese: a test for five candidate genes for bone mass.
16105030 2005 Structure of non-(1-84) PTH fragments secreted by parathyroid glands in primary and secondary hyperparathyroidism.
16081646 2005 Chronic elevation of parathyroid hormone in mice reduces expression of sclerostin by osteocytes: a novel mechanism for hormonal control of osteoblastogenesis.
15962290 2005 Effects of parathyroid hormone on Wnt signaling pathway in bone.
15917161 2005 Bone mineral density and five prominent candidate genes in Chinese men: associations, interaction effects and their implications.
15890770 2005 Transactivation of the parathyroid hormone promoter by specificity proteins and the nuclear factor Y complex.
15826940 2005 Backbone-methylated analogues of the principle receptor binding region of human parathyroid hormone. Evidence for binding to both the N-terminal extracellular domain and extracellular loop region.
15824859 2005 Identification and characterization of cis-acting elements in the human and bovine PTH mRNA 3'-untranslated region.
15808916 2005 Carboxy-terminal PTH fragments stimulate [3H]thymidine incorporation in vascular endothelial cells.
15769857 2005 Parathyroid hormone decreases renal vitamin D receptor expression in vivo.
15707954 2005 Negative regulation of human parathyroid hormone gene promoter by vitamin D3 through nuclear factor Y.
15639837 2003 [Association study of RFLP of parathyroid hormone gene and bone mineral density in postmenopausal women].
15515479 2004 Close association between parathyroid hormone and left ventricular function and structure in end-stage renal failure patients under maintenance hemodialysis.
15514034 2005 The protein phosphatase calcineurin determines basal parathyroid hormone gene expression.
15504937 2004 Mechanisms of mitogen-activated protein kinase inhibition by parathyroid hormone in osteoblast-like cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15472173 2004 Parathyroid hormone gene polymorphism and sporadic idiopathic hypoparathyroidism.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15297458 2004 Suppression of the human parathyroid hormone promoter by vitamin D involves displacement of NF-Y binding to the vitamin D response element.
15240611 2004 Changes in serum receptor activator of nuclear factor-kappaB ligand, osteoprotegerin, and interleukin-6 levels in patients with glucocorticoid-induced osteoporosis treated with human parathyroid hormone (1-34).
15227728 2004 Structure and function of a minimal receptor activation domain of parathyroid hormone.
15186723 2004 The role of BMP-6, IL-6, and BMP-4 in mesenchymal stem cell-dependent bone development: effects on osteoblastic differentiation induced by parathyroid hormone and vitamin D(3).
15080150 2004 Does bone resorption inhibition affect the anabolic response to parathyroid hormone?
15070925 2004 The effects of age and other variables on serum parathyroid hormone in postmenopausal women attending an osteoporosis center.
15070914 2004 Serum parathyroid hormone predicts time to fall independent of vitamin D status in a frail elderly population.
15035617 2004 Cooperative interaction of arginine-19 and the N-terminal signaling domain in the affinity and potency of parathyroid hormone.
14969386 2004 PTH/PTHrP activity and the programming of skeletal development in utero.
14730973 2004 Toward parathyroid hormone minimization: conformational studies of cyclic PTH(1-14) analogues.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14506618 2003 Genetic effects of estrogen receptor alpha and collagen IA1 genes on the relationships of parathyroid hormone and 25 hydroxyvitamin D with bone mineral density in Caucasian women.
12947048 2003 Identification of a contact site for residue 19 of parathyroid hormone (PTH) and PTH-related protein analogs in transmembrane domain two of the type 1 PTH receptor.
12914574 2003 Differentiation of Caucasians and Chinese at bone mass candidate genes: implication for ethnic difference of bone mass.
12905817 2001 [Polymorphism of parathyroid hormone gene and its association with bone mineral density of Han nationality women in Beijing area].
12893275 2003 Parathyroid hormone gene with bone phenotypes in Chinese.
12490859 2002 Elevated serum parathormone level after "concise parathyroidectomy" for primary sporadic hyperparathyroidism.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12403624 2002 Residue 19 of the parathyroid hormone (PTH) modulates ligand interaction with the juxtamembrane region of the PTH-1 receptor.
12369776 2002 Parathyroid hormone and periosteal bone expansion.
12364326 2002 Parathyroid hormone stimulates receptor activator of NFkappa B ligand and inhibits osteoprotegerin expression via protein kinase A activation of cAMP-response element-binding protein.
12207101 2002 Advanced oxidation protein products, parathyroid hormone and vascular calcification in uremia.
12195069 2002 Association of bone metabolism regulatory factor gene polymorphisms with susceptibility to ossification of the posterior longitudinal ligament of the spine and its severity.
12046039 2002 Parathyroid hormone gene polymorphism and secondary hyperparathyroidism in hemodialysis patients.
12036966 2002 Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Galpha(s) carboxyl terminus.
11984699 2002 Association of gene polymorphisms and bone density in Japanese girls.
11956184 2002 New signaling pathway for parathyroid hormone and cyclic AMP action on extracellular-regulated kinase and cell proliferation in bone cells. Checkpoint of modulation by cyclic AMP.
11918225 2002 Tests of linkage and/or association of genes for vitamin D receptor, osteocalcin, and parathyroid hormone with bone mineral density.
11467957 2001 Structural requirements for conserved arginine of parathyroid hormone.
11278902 2001 Marked differences between metalloproteases meprin A and B in substrate and peptide bond specificity.
10913913 2000 In vivo regulation of apoptosis in metaphyseal trabecular bone of young rats by synthetic human parathyroid hormone (1-34) fragment.
10837469 2000 Crystal structure of human parathyroid hormone 1-34 at 0.9-A resolution.
10623601 2000 Solution structures of human parathyroid hormone fragments hPTH(1-34) and hPTH(1-39) and bovine parathyroid hormone fragment bPTH(1-37).
10523031 1999 A novel mutation of the signal peptide of the preproparathyroid hormone gene associated with autosomal recessive familial isolated hypoparathyroidism.
10499494 1999 Comparison of rat and human parathyroid hormone 2 (PTH2) receptor activation: PTH is a low potency partial agonist at the rat PTH2 receptor.
9927325 1999 Human osteoclast-like cells are formed from peripheral blood mononuclear cells in a coculture with SaOS-2 cells transfected with the parathyroid hormone (PTH)/PTH-related protein receptor gene.
9482662 1998 Multiple regions of ligand discrimination revealed by analysis of chimeric parathyroid hormone 2 (PTH2) and PTH/PTH-related peptide (PTHrP) receptors.
9108031 1997 Direct mapping of an agonist-binding domain within the parathyroid hormone/parathyroid hormone-related protein receptor by photoaffinity crosslinking.
8922395 1996 Differential effects of parathyroid hormone fragments on collagen gene expression in chondrocytes.
8344299 1993 Stabilized NMR structure of human parathyroid hormone(1-34).
7829495 1995 Inefficient membrane targeting, translocation, and proteolytic processing by signal peptidase of a mutant preproparathyroid hormone protein.
7797535 1995 Identification and functional expression of a receptor selectively recognizing parathyroid hormone, the PTH2 receptor.
7797503 1995 Structure of human parathyroid hormone 1-37 in solution.
7721880 1995 Proparathyroid hormone is preferentially cleaved to parathyroid hormone by the prohormone convertase furin. A mass spectrometric study.
6950381 1981 Nucleotide sequence of cloned cDNAs encoding human preproparathyroid hormone.
6885073 1983 Assignment of the human parathyroid hormone gene to chromosome 11.
6220408 1983 Nucleotide sequence of the human parathyroid hormone gene.
4833516 1974 Structural analysis of human proparathyroid hormone by a new microsequencing approach.
4721748 1973 [Synthesis of sequence 1-34 of human parathyroid hormone].
4521809 1974 The amino-acid sequence of the amino-terminal 37 residues of human parathyroid hormone.
4474131 1974 Solid-phase synthesis of the biologically active N-terminal 1 - 34 peptide of human parathyroid hormone.
3005800 1986 Familial isolated hypoparathyroidism: a molecular genetic analysis of 8 families with 23 affected persons.
2215618 1990 Hypercalcemia and ectopic secretion of parathyroid hormone by an ovarian carcinoma with rearrangement of the gene for parathyroid hormone.
2212001 1990 Mutation of the signal peptide-encoding region of the preproparathyroid hormone gene in familial isolated hypoparathyroidism.
2069952 1991 Investigation of the solution structure of the human parathyroid hormone fragment (1-34) by 1H NMR spectroscopy, distance geometry, and molecular dynamics calculations.
1672845 1991 Regional mapping of the parathyroid hormone gene (PTH) by cytogenetic and molecular studies.
1474331 1992 Ectopic transcription of the parathyroid hormone gene in lymphocytes, lymphoblastoid cells and tumour tissue.
1302009 1992 A donor splice site mutation in the parathyroid hormone gene is associated with autosomal recessive hypoparathyroidism.
1125201 1975 A reinvestigation of the amino-terminal sequence of human parathyroid hormone.
728431 1978 Complete amino acid sequence of human parathyroid hormone.