Property Summary

NCBI Gene PubMed Count 159
Grant Count 159
R01 Count 105
Funding $20,950,839.41
PubMed Score 7391.95
PubTator Score 2484.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -1.400 0.000
posterior fossa group B ependymoma 1.200 0.000
psoriasis -2.000 0.000

Synonym

Accession P01266 O15274 O43899 Q15593 Q15948 Q9NYR1 Q9NYR2 Q9UMZ0 Q9UNY3 Tg
Symbols TGN
AITD3

Gene

TG

PANTHER Protein Class (2)

Gene RIF (122)

PMID Text
26963610 +49A/G and CT60 polymorphism of CTLA4 and E33 polymorphism of TG may be genetic risk factors for autoimmune hypothyroidism susceptibility.
26896794 The system is characterized by a very high sensitivity and specificity allowing the ex-vivo detection of sub ng/ml concentrations of human Thyroglobulin from needle washouts of fine-needle aspiration biopsies of thyroid nodule from different patients.
26777470 22 rare non-polymorphic variants including six truncating variants and 16 missense variants of unknown significance in Chinese patients with congenital hypothyroidism.
26595189 Data suggest that primary functions of TG include iodide storage and thyroid hormonogenesis; combinations of nonsense mutations, frameshift mutations, splice site mutations, and missense mutations in TG occur spontaneously to cause congenital hypothyroidism and thyroidal endoplasmic reticulum stress. [REVIEW]
26099577 Tg SNP haplotypes are associated with hypothyroidism, hyperthyroidism and Hashimoto's disease.
25895485 A prominent transient early increase in thyroglobulin levels was found in thyroid cancer patients post-radioiodine ablation.
25893415 High Thyroglobulin Levels are associated with recurrence in Thyroid Carcinoma.
25633667 Results from a Vietnamese family with goiter and hypothyroidism identified 2 novel mutations in thyroglobulin gene resulting in the abolition of the authentic splice donor sites.
25607926 In the diagnosis of lymphatic metastasis in papillary thyroid carcinoma, FNA-Tg levels in the preoperative state are affected by serum Tg levels when they exceeded 1.0 mug/L.
25536321 The mean and median of thyroglobulin were calculated in these subgroups. Tg concentrations were dependent on gender/
More...

AA Sequence

MALVLEIFTLLASICWVSANIFEYQVDAQPLRPCELQRETAFLKQADYVPQCAEDGSFQTVQCQNDGRSC      1 - 70
WCVGANGSEVLGSRQPGRPVACLSFCQLQKQQILLSGYINSTDTSYLPQCQDSGDYAPVQCDVQQVQCWC     71 - 140
VDAEGMEVYGTRQLGRPKRCPRSCEIRNRRLLHGVGDKSPPQCSAEGEFMPVQCKFVNTTDMMIFDLVHS    141 - 210
YNRFPDAFVTFSSFQRRFPEVSGYCHCADSQGRELAETGLELLLDEIYDTIFAGLDLPSTFTETTLYRIL    211 - 280
QRRFLAVQSVISGRFRCPTKCEVERFTATSFGHPYVPSCRRNGDYQAVQCQTEGPCWCVDAQGKEMHGTR    281 - 350
QQGEPPSCAEGQSCASERQQALSRLYFGTSGYFSQHDLFSSPEKRWASPRVARFATSCPPTIKELFVDSG    351 - 420
LLRPMVEGQSQQFSVSENLLKEAIRAIFPSRGLARLALQFTTNPKRLQQNLFGGKFLVNVGQFNLSGALG    421 - 490
TRGTFNFSQFFQQLGLASFLNGGRQEDLAKPLSVGLDSNSSTGTPEAAKKDGTMNKPTVGSFGFEINLQE    491 - 560
NQNALKFLASLLELPEFLLFLQHAISVPEDVARDLGDVMETVLSSQTCEQTPERLFVPSCTTEGSYEDVQ    561 - 630
CFSGECWCVNSWGKELPGSRVRGGQPRCPTDCEKQRARMQSLMGSQPAGSTLFVPACTSEGHFLPVQCFN    631 - 700
SECYCVDAEGQAIPGTRSAIGKPKKCPTPCQLQSEQAFLRTVQALLSNSSMLPTLSDTYIPQCSTDGQWR    701 - 770
QVQCNGPPEQVFELYQRWEAQNKGQDLTPAKLLVKIMSYREAASGNFSLFIQSLYEAGQQDVFPVLSQYP    771 - 840
SLQDVPLAALEGKRPQPRENILLEPYLFWQILNGQLSQYPGSYSDFSTPLAHFDLRNCWCVDEAGQELEG    841 - 910
MRSEPSKLPTCPGSCEEAKLRVLQFIRETEEIVSASNSSRFPLGESFLVAKGIRLRNEDLGLPPLFPPRE    911 - 980
AFAEQFLRGSDYAIRLAAQSTLSFYQRRRFSPDDSAGASALLRSGPYMPQCDAFGSWEPVQCHAGTGHCW    981 - 1050
CVDEKGGFIPGSLTARSLQIPQCPTTCEKSRTSGLLSSWKQARSQENPSPKDLFVPACLETGEYARLQAS   1051 - 1120
GAGTWCVDPASGEELRPGSSSSAQCPSLCNVLKSGVLSRRVSPGYVPACRAEDGGFSPVQCDQAQGSCWC   1121 - 1190
VMDSGEEVPGTRVTGGQPACESPRCPLPFNASEVVGGTILCETISGPTGSAMQQCQLLCRQGSWSVFPPG   1191 - 1260
PLICSLESGRWESQLPQPRACQRPQLWQTIQTQGHFQLQLPPGKMCSADYADLLQTFQVFILDELTARGF   1261 - 1330
CQIQVKTFGTLVSIPVCNNSSVQVGCLTRERLGVNVTWKSRLEDIPVASLPDLHDIERALVGKDLLGRFT   1331 - 1400
DLIQSGSFQLHLDSKTFPAETIRFLQGDHFGTSPRTWFGCSEGFYQVLTSEASQDGLGCVKCPEGSYSQD   1401 - 1470
EECIPCPVGFYQEQAGSLACVPCPVGRTTISAGAFSQTHCVTDCQRNEAGLQCDQNGQYRASQKDRGSGK   1471 - 1540
AFCVDGEGRRLPWWETEAPLEDSQCLMMQKFEKVPESKVIFDANAPVAVRSKVPDSEFPVMQCLTDCTED   1541 - 1610
EACSFFTVSTTEPEISCDFYAWTSDNVACMTSDQKRDALGNSKATSFGSLRCQVKVRSHGQDSPAVYLKK   1611 - 1680
GQGSTTTLQKRFEPTGFQNMLSGLYNPIVFSASGANLTDAHLFCLLACDRDLCCDGFVLTQVQGGAIICG   1681 - 1750
LLSSPSVLLCNVKDWMDPSEAWANATCPGVTYDQESHQVILRLGDQEFIKSLTPLEGTQDTFTNFQQVYL   1751 - 1820
WKDSDMGSRPESMGCRKDTVPRPASPTEAGLTTELFSPVDLNQVIVNGNQSLSSQKHWLFKHLFSAQQAN   1821 - 1890
LWCLSRCVQEHSFCQLAEITESASLYFTCTLYPEAQVCDDIMESNAQGCRLILPQMPKALFRKKVILEDK   1891 - 1960
VKNFYTRLPFQKLMGISIRNKVPMSEKSISNGFFECERRCDADPCCTGFGFLNVSQLKGGEVTCLTLNSL   1961 - 2030
GIQMCSEENGGAWRILDCGSPDIEVHTYPFGWYQKPIAQNNAPSFCPLVVLPSLTEKVSLDSWQSLALSS   2031 - 2100
VVVDPSIRHFDVAHVSTAATSNFSAVRDLCLSECSQHEACLITTLQTQPGAVRCMFYADTQSCTHSLQGQ   2101 - 2170
NCRLLLREEATHIYRKPGISLLSYEASVPSVPISTHGRLLGRSQAIQVGTSWKQVDQFLGVPYAAPPLAE   2171 - 2240
RRFQAPEPLNWTGSWDASKPRASCWQPGTRTSTSPGVSEDCLYLNVFIPQNVAPNASVLVFFHNTMDREE   2241 - 2310
SEGWPAIDGSFLAAVGNLIVVTASYRVGVFGFLSSGSGEVSGNWGLLDQVAALTWVQTHIRGFGGDPRRV   2311 - 2380
SLAADRGGADVASIHLLTARATNSQLFRRAVLMGGSALSPAAVISHERAQQQAIALAKEVSCPMSSSQEV   2381 - 2450
VSCLRQKPANVLNDAQTKLLAVSGPFHYWGPVIDGHFLREPPARALKRSLWVEVDLLIGSSQDDGLINRA   2451 - 2520
KAVKQFEESRGRTSSKTAFYQALQNSLGGEDSDARVEAAATWYYSLEHSTDDYASFSRALENATRDYFII   2521 - 2590
CPIIDMASAWAKRARGNVFMYHAPENYGHGSLELLADVQFALGLPFYPAYEGQFSLEEKSLSLKIMQYFS   2591 - 2660
HFIRSGNPNYPYEFSRKVPTFATPWPDFVPRAGGENYKEFSELLPNRQGLKKADCSFWSKYISSLKTSAD   2661 - 2730
GAKGGQSAESEEEELTAGSGLREDLLSLQEPGSKTYSK                                   2731 - 2768
//

Text Mined References (160)

PMID Year Title
26963610 2016 Association of Cytotoxic T-Lymphocyte Antigen 4 (CTLA4) and Thyroglobulin (TG) Genetic Variants with Autoimmune Hypothyroidism.
26896794 2016 Long period fiber grating nano-optrode for cancer biomarker detection.
26777470 2016 Thyroglobulin gene mutations in Chinese patients with congenital hypothyroidism.
26595189 2016 Thyroglobulin From Molecular and Cellular Biology to Clinical Endocrinology.
26099577 2015 Correlation between thyroglobulin gene polymorphisms and autoimmune thyroid disease.
25895485 2015 Transient early increase in thyroglobulin levels post-radioiodine ablation in patients with differentiated thyroid cancer.
25893415 2015 Undetectable Thyroglobulin Levels in Poorly Differentiated Thyroid Carcinoma Patients Free of Macroscopic Disease After Initial Treatment: Are They Useful?
25633667 2015 Novel compound heterozygous Thyroglobulin mutations c.745+1G>A/c.7036+2T>A associated with congenital goiter and hypothyroidism in a Vietnamese family. Identification of a new cryptic 5' splice site in the exon 6.
25607926 2015 Thyroglobulin level in fine-needle aspirates for preoperative diagnosis of cervical lymph node metastasis in patients with papillary thyroid carcinoma: two different cutoff values according to serum thyroglobulin level.
25536321 2015 The relationship between iodine intake and serum thyroglobulin in the general population.
More...