Property Summary

NCBI Gene PubMed Count 343
Grant Count 589
R01 Count 361
Funding $69,109,635.7
PubMed Score 8776.72
PubTator Score 1911.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (63)

Disease Z-score Confidence
Osteoporosis 257 7.169 3.6
Hypercalcemia 37 6.627 3.3
Paget's disease of bone 28 6.464 3.2
Cancer 2,346 6.194 3.1
Multiple endocrine neoplasia type 2A 22 6.026 3.0
Hyperparathyroidism 43 5.868 2.9
Multiple endocrine neoplasia type 2B 16 5.415 2.7
Goiter 27 5.161 2.6
Complex regional pain syndrome 12 5.159 2.6
Hypoparathyroidism 29 4.558 2.3
Parathyroid Adenoma 11 4.314 2.2
Osteomalacia 28 4.18 2.1
Kidney failure 39 4.127 2.1
Adenoma 165 4.006 2.0
Phaeochromocytoma 20 3.869 1.9
Hypophosphatemia 31 3.846 1.9
Spinal stenosis 15 3.838 1.9
Pain agnosia 99 3.779 1.9
Renal osteodystrophy 10 3.754 1.9
Hyperthyroidism 50 3.739 1.9
Diarrhea 155 3.722 1.9
Osteitis fibrosa 6 3.712 1.9
Autoimmune thyroiditis 24 3.681 1.8
Arthritis 248 3.483 1.7
Osteosclerosis 10 3.471 1.7
Osteogenesis imperfecta 34 3.449 1.7
Migraine 79 3.386 1.7
Cushing's syndrome 47 3.381 1.7
Thyroid adenoma 9 3.355 1.7
Root resorption 21 3.354 1.7
Rickets 42 3.293 1.6
Thyroiditis 25 3.274 1.6
Hypothyroidism 89 3.273 1.6
Thyrotoxicosis 38 3.206 1.6
Calcinosis 62 3.049 1.5
Hypogonadism 70 3.038 1.5
Pancreatitis 97 3.007 1.5
Arthritis, Experimental 39
Autistic Disorder 320
Bronchial Hyperreactivity 13
Catalepsy 15
Common Migraine 11
Degenerative polyarthritis 93
Down syndrome 548
Edema 38
Hyperactive behavior 31
Hyperalgesia 71
Hypertensive disease 193
Inflammation 109
Intellectual disability 573
Migraine Disorders 26
Neurogenic Inflammation 12
Prostatic Neoplasms 471
Pulmonary Fibrosis 66
Pulmonary hypertension 52
Sciatic Neuropathy 5
adult high grade glioma 2,148
glioblastoma 5,572
head and neck cancer and chronic obstruc... 237 
lung cancer 4,466
lung carcinoma 2,844
medulloblastoma, large-cell 6,234
psoriasis 6,685

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma -1.200 0.000
medulloblastoma, large-cell -1.300 0.000
lung cancer 2.000 0.003
adult high grade glioma -1.200 0.001
lung carcinoma 2.000 0.000
head and neck cancer and chronic obstruc... -1.800 0.012
psoriasis 2.700 0.000

Synonym

Accession P01258 B7ZL39 Q13935 Q13937 Q52LX7
Symbols CT
KC
PCT
CGRP
CALC1
CGRP1
CGRP-I

Gene

PANTHER Protein Class (2)

PDB

2JXZ  

Gene RIF (281)

PMID Text
27096761 The study simultaneously evaluated both PCT and soluble TREM-1 along with CRP in febrile patients with autoimmune diseases.
27012052 PCT does not seem to be suitable for detecting pancreatic fistula after pancreatoduodenectomy.
26986140 blood PCT sufficient to confirm or exclude bacterial meningitis diagnosis [meta-analysis]
26666342 Patients with acute heart failure and bacterial infections had significantly elevated levels of procalcitonin and poorer outcomes.
26636517 Procalcitonin serum levels were significant biomarker for the diagnosis of bacterial pneumonia in children.
26596282 These experimental observations, suggesting that hCt senses Ca(2+) concentration variations, strengthen the hypothesis that channel formation represents an extra source of Ca(2+) entry into osteoclasts
26495299 Procalcitonin, uric acid, and BNP had significant relationship with many echocardiographic findings in participants. For patients, procalcitonin did not show correlation.
26482503 miR-125b modulates PCT expression by manipulating the amount and transcriptional activity of Stat3.
26481456 Calcitonin is specifically expressed in sera of medullary thyroid carcinoma patients. (Review)
26271020 Among adrenomedullin, CRP, and PCT, procalcitonin demonstrates the highest correlation with the severity of infection.
More...

AA Sequence

MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQNYVQMKASELEQEQ      1 - 70
EREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNA     71 - 140
N//

Text Mined References (344)

PMID Year Title
27096761 2016 Prospective Evaluation of Procalcitonin, Soluble Triggering Receptor Expressed on Myeloid Cells-1 and C-Reactive Protein in Febrile Patients with Autoimmune Diseases.
27012052 2016 Procalcitonin--a Marker for Anastomotic Insufficiency after Pancreatoduodenectomy?
26986140 2016 Diagnostic Accuracy of Procalcitonin in Bacterial Meningitis Versus Nonbacterial Meningitis: A Systematic Review and Meta-Analysis.
26666342 2016 Procalcitonin-based indication of bacterial infection identifies high risk acute heart failure patients.
26636517 2015 Clinical significance of serum procalcitonin level monitoring on early diagnosis of severe pneumonia on children.
26596282 2016 Effect of calcium ions on human calcitonin. Possible implications for bone resorption by osteoclasts.
26495299 2015 Comparison between procalcitonin, brain natriuretic peptide, and uric acid in children with cardiomyopathy and controls.
26482503 2016 miR-125b regulates procalcitonin production in monocytes by targeting Stat3.
26481456 2016 Use of fine-needle aspirate calcitonin to detect medullary thyroid carcinoma: A systematic review.
26271020 2015 Adrenomedullin--A New Marker in Febrile Neutropenia: Comparison With CRP and Procalcitonin.
More...