Property Summary

NCBI Gene PubMed Count 386
PubMed Score 8831.26
PubTator Score 1911.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Protein-protein Interaction (7)

Gene RIF (323)

AA Sequence

MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQNYVQMKASELEQEQ      1 - 70
EREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNA     71 - 140
N//

Text Mined References (387)

PMID Year Title