Property Summary

NCBI Gene PubMed Count 38
PubMed Score 1736.70
PubTator Score 11.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
pituitary cancer -5.400 1.3e-14

Gene RIF (19)

AA Sequence

MAAGSRTSLLLAFGLLCLSWLQEGSAFPTIPLSRLFDNAMLRARRLYQLAYDTYQEFEEAYILKEQKYSF      1 - 70
LQNPQTSLCFSESIPTPSNRVKTQQKSNLELLRISLLLIQSWLEPVQLLRSVFANSLVYGASDSNVYRHL     71 - 140
KDLEEGIQTLMWRLEDGSPRTGQIFNQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRS    141 - 210
VEGSCGF                                                                   211 - 217
//

Text Mined References (43)

PMID Year Title