Property Summary

NCBI Gene PubMed Count 38
Grant Count 680
R01 Count 257
Funding $68,045,609.15
PubMed Score 1735.52
PubTator Score 11.53

Knowledge Summary

Patent

No data available

Synonym

Accession P01242 B1A4H5 B1A4H7 O14643 O14644 P09587 GH-V
Symbols GHL
GHV
GH-V
GHB2
hGH-V

Gene

GH2

PANTHER Protein Class (2)

Gene RIF (20)

PMID Text
26589570 Type 1 diabetic women delivering large for gestational age infants had lower placental GH levels in early pregnancy.
24035309 genetic association studies in populations in Estonia, Czech Republic, and Bashkortostan/Russia: Data suggest an SNP in GH2 (rs2006123) is associated with adult height (not body mass index); A-allele is associated with taller stature. [META-ANALYSIS]
23178941 Overexpression of phosphatidylinositol 4 phosphate 5-kinase (PIP5K) suppresses HIV-1 Tat-mediated inhibition of growth hormone secretion from cells
23178941 Overexpression of phosphatidylinositol 4 phosphate 5-kinase (PIP5K) suppresses HIV-1 Tat-mediated inhibition of growth hormone secretion from cells
22489624 Maternal serum PGH at 11-13 weeks' gestation is unlikely to be a useful biochemical marker for early prediction of small for gestational age neonates.
22387044 results are consistent with a pleiotropic effect of placental hGH/CSH genes at the maternal-fetal interface relating to the regulation of fetal growth and the risk of affected maternal metabolism.
22363400 These results suggest that the normal PGH-IGF-I-IGFBP3 axis in pregnancy is abnormal in Type 1 Diabetic pregnancies.
20403354 Observational study of gene-disease association. (HuGE Navigator)
20005926 The hGH-V promoter activity and the endogenous mRNA expression in human placental choriocarcinoma cell line JAR in the presence of glucose and demethylating genome conditions, were compared.
19844941 early first trimester maternal serum marker for Down syndrome
More...

AA Sequence

MAAGSRTSLLLAFGLLCLSWLQEGSAFPTIPLSRLFDNAMLRARRLYQLAYDTYQEFEEAYILKEQKYSF      1 - 70
LQNPQTSLCFSESIPTPSNRVKTQQKSNLELLRISLLLIQSWLEPVQLLRSVFANSLVYGASDSNVYRHL     71 - 140
KDLEEGIQTLMWRLEDGSPRTGQIFNQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRS    141 - 210
VEGSCGF                                                                   211 - 217
//

Text Mined References (43)

PMID Year Title
26862561 2016 Curated eutherian third party data gene data sets.
26697363 2015 Third party data gene data set of eutherian growth hormone genes.
26589570 2015 Lower levels of placental growth hormone in early pregnancy in women with type 1 diabetes and large for gestational age infants.
24035309 2013 Developmental programming of growth: genetic variant in GH2 gene encoding placental growth hormone contributes to adult height determination.
22489624 2012 Maternal serum placental growth hormone at 11-13 weeks' gestation in pregnancies delivering small for gestational age neonates.
22387044 2012 Differential placental expression profile of human Growth Hormone/Chorionic Somatomammotropin genes in pregnancies with pre-eclampsia and gestational diabetes mellitus.
22363400 2012 Maternal and fetal placental growth hormone and IGF axis in type 1 diabetic pregnancy.
20403354 2010 A population-based study of IGF axis polymorphisms and the esophageal inflammation, metaplasia, adenocarcinoma sequence.
20005926 2010 hGH-V gene expression and promoter activity under glucose and 5-azacytidine (5azaC) effects.
19844941 2009 Placental growth hormone and growth hormone binding protein are first trimester maternal serum markers of Down syndrome.
More...