Property Summary

NCBI Gene PubMed Count 407
PubMed Score 1736.70
PubTator Score 270.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
pituitary cancer 1972 2.6e-16
psoriasis 6694 1.9e-04
diabetes mellitus 1728 1.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Isolated growth hormone deficiency 30 0.0 5.0

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus 1.300 1.4e-03
pituitary cancer -9.900 2.6e-16
psoriasis -1.200 1.9e-04

Protein-protein Interaction (1)

Gene RIF (355)

AA Sequence

MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSF      1 - 70
LQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLL     71 - 140
KDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRS    141 - 210
VEGSCGF                                                                   211 - 217
//

Text Mined References (413)

PMID Year Title