Property Summary

NCBI Gene PubMed Count 243
PubMed Score 9998.38
PubTator Score 9150.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
group 4 medulloblastoma 1875 5.69264891527719E-8
malignant mesothelioma 3163 7.92219270272437E-8
pituitary cancer 1972 2.21252752090984E-7
medulloblastoma, large-cell 6234 2.64671300930063E-6
glioblastoma 5572 0.0110671407038731
Disease Target Count Z-score Confidence
Heart disease 279 0.0 1.0
Neuroblastoma 78 0.0 2.0
Paget's disease of bone 28 0.0 1.0

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma -2.900 0.000
group 4 medulloblastoma 5.400 0.000
glioblastoma 1.100 0.011
medulloblastoma, large-cell 3.600 0.000
pituitary cancer -7.300 0.000

Synonym

Accession P01236 Q15199 Q92996 PRL
Symbols GHA1

Gene

PRL

PANTHER Protein Class (2)

PDB

3D48   3MZG   3N06   3N0P   3NCB   3NCC   3NCE   3NCF   1RW5   2Q98   3EW3   3NPZ  

  Ortholog (13)

 GO Function (1)

Gene RIF (226)

PMID Text
27003261 PAK1 nuclear translocation is ligand-dependent: only PRL but not E2 stimulated PAK1 nuclear translocation
26831552 Data suggest that plasma kisspeptin and serum prolactin levels may be involved in the physiopathology of breast enlargement in newborns.
26720589 prolactin levels and pituitary adenoma diameters may be associated with increased risk of cancer in patients with prolactinoma
26691151 the -1189 estrogen response element is the dominant response element involved in the human PRL transcriptional response.
26586670 PRL-PRLR can escalate the impact of breast cancer on bone metastasis and the presence of PRLR in the tumor microenvironment of breast cancer bone metastasis has the potential to modulate the microenvironment to induce lytic osteoclast formation.
26583155 findings revealed that the -1149TT genotype was correlated with higher levels of prolactin in serum and prolactin gene expression in peripheral blood mononuclear cells in women with systemic lupus erythematosus; study suggests that the -1149TT genotype may be a risk factor for lupus
26370377 Mean serum prolactin level was higher in the patients with recurrent miscarriage than in healthy women.
26299069 Patients with diabetes mellitus and impaired renal function demonstrate a high urinary PRL excretion.
26179930 The results of our study suggest the association between vitamin D status and elevated macroprolactin levels in premenopausal women.
26160091 Cord blood prolactin level showed weak correlation with duration of full obstetric delivery, and duration of the second stage.
More...

AA Sequence

MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDK      1 - 70
RYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAI     71 - 140
LSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKI    141 - 210
DNYLKLLKCRIIHNNNC                                                         211 - 227
//

Text Mined References (245)

PMID Year Title
27003261 2016 PAK1 translocates into nucleus in response to prolactin but not to estrogen.
26862561 2016 Curated eutherian third party data gene data sets.
26831552 2015 Plasma Kisspeptin Levels in Newborn Infants with Breast Enlargement.
26720589 2016 Increased micronucleus, nucleoplasmic bridge, nuclear bud frequency and oxidative DNA damage associated with prolactin levels and pituitary adenoma diameters in patients with prolactinoma.
26697363 2015 Third party data gene data set of eutherian growth hormone genes.
26691151 2016 Role of Estrogen Response Element in the Human Prolactin Gene: Transcriptional Response and Timing.
26586670 2016 The Role of Prolactin in Bone Metastasis and Breast Cancer Cell-Mediated Osteoclast Differentiation.
26583155 2015 Prolactin and Dehydroepiandrosterone Levels in Women with Systemic Lupus Erythematosus: The Role of the Extrapituitary Prolactin Promoter Polymorphism at -1149G/T.
26370377 2015 Recurrent miscarriage is associated with the dopamine receptor (DRD2) genotype.
26299069 2015 High Prolactin Excretion in Patients with Diabetes Mellitus and Impaired Renal Function.
More...