Property Summary

NCBI Gene PubMed Count 75
PubMed Score 538.12
PubTator Score 324.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus 1.500 1.0e-03
ovarian cancer -2.000 8.7e-07
pituitary cancer -2.300 1.5e-03

Protein-protein Interaction (1)

Gene RIF (48)

AA Sequence

MEMLQGLLLLLLLSMGGAWASREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLP      1 - 70
PLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLF     71 - 140
L//

Text Mined References (76)

PMID Year Title