Property Summary

NCBI Gene PubMed Count 73
Grant Count 74
R01 Count 46
Funding $14,635,219.82
PubMed Score 470.51
PubTator Score 324.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus 1.500 0.001
ovarian cancer -2.000 0.000
pituitary cancer -2.300 0.002

Synonym

Accession P01229 Q9UDI0 Lutropin beta chain
Symbols CGB4
HH23
LSH-B
LSH-beta

Gene

LHB

PANTHER Protein Class (2)

PDB

1M92  

Gene RIF (46)

PMID Text
26662070 LHbeta G1052A and LHCGR G935A genes polymorphisms are associated with increased risk of polycystic ovary syndrome in Egyptian women especially in obese cases.
25935136 The Trp8Arg/Ile15Thr polymorphism within the LHB gene was not associated with endometriosis and infertility.
25820123 This paper shows a conclusive contribution of Variant-Luteinizing hormone to the natural variance in male serum Luteinizing hormone levels
25111116 Data indicate a modulatory effect of luteinizing hormone beta-subunit (LHB) gene polymorphisms on hyperandrogenemia phenotype of Polycystic Ovary Syndrome (PCOS) was observed.
24625195 No association was found between poor ovarian response to ovarian stimulation and variant-betaLH.
24297486 LH, progesterone, and TSH can stimulate aldosterone.
23725475 the frequency of v-betaLH in Denmark is similar to a number of European countries
23160221 Both estradiol and progesterone uniquely modulate basal and GnRH-stimulated gonadotropin promoters without affecting cell growth.
23015653 Negative fetal FSH/LH regulation in late pregnancy is associated with declined kisspeptin/KISS1R expression in the tuberal hypothalamus.
22865884 FOXO1 transcription factor inhibits luteinizing hormone beta gene expression in pituitary gonadotrope cells
More...

AA Sequence

MEMLQGLLLLLLLSMGGAWASREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLP      1 - 70
PLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLF     71 - 140
L//

Text Mined References (74)

PMID Year Title
26662070 2016 Association between genes encoding components of the Leutinizing hormone/Luteinizing hormone-choriogonadotrophin receptor pathway and polycystic ovary syndrome in Egyptian women.
25935136 2015 LH (Trp8Arg/Ile15Thr), LHR (insLQ) and FSHR (Asn680Ser) polymorphisms genotypic prevalence in women with endometriosis and infertility.
25820123 2015 'Carriers of variant luteinizing hormone (V-LH) among 1593 Baltic men have significantly higher serum LH'.
25111116 2014 Trp28Arg/Ile35Thr LHB gene variants are associated with elevated testosterone levels in women with polycystic ovary syndrome.
24625195 2014 Variant-beta luteinizing hormone is not associated with poor ovarian response to controlled ovarian hyperstimulation.
24297486 2014 LH, progesterone, and TSH can stimulate aldosterone in vitro: a study on normal adrenal cortex and aldosterone producing adenoma.
23725475 2013 A common polymorphic allele of the LH beta-subunit gene is associated with higher exogenous FSH consumption during controlled ovarian stimulation for assisted reproductive technology.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23160221 2012 Effects of estradiol and progesterone on gonadotropin LH?- and FSH?-subunit promoter activities in gonadotroph L?T2 cells.
23015653 2012 Negative fetal FSH/LH regulation in late pregnancy is associated with declined kisspeptin/KISS1R expression in the tuberal hypothalamus.
More...