Property Summary

NCBI Gene PubMed Count 89
PubMed Score 143.34
PubTator Score 290.66

Knowledge Summary

Patent

No data available

 HCA RNA Cell Line (1)

Protein-protein Interaction (1)

Gene RIF (58)

AA Sequence

MKTLQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCT      1 - 70
FKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE                71 - 129
//

Text Mined References (90)

PMID Year Title