Property Summary

NCBI Gene PubMed Count 79
Grant Count 35
R01 Count 30
Funding $1,683,713.22
PubMed Score 147.18
PubTator Score 290.66

Knowledge Summary

Patent

No data available

Gene RIF (49)

PMID Text
25052309 The FSHB -211G>T variant attenuates serum FSH levels in the supraphysiological gonadotropin setting of Klinefelter syndrome
24718625 3 known FSH-action modulating SNPs (FSHB -211G/T; FSHR -29G/A, c.2039 A/G)explained together 2.3%, 1.4%, 1.0 and 1.1% of the measured variance in serum FSH, Inhibin B, testosterone and total testes volume, respectively.
23850305 The combined effect of FSHB GG+FSHR AA may potentiate the FSH pathway, which increases serum levels of FSH and reduces antimullerian hormone in health girls.
23766128 Data suggest that low serum FSH levels in men with an SNP in promoter region of FSHB (-211G/T) result from reduced binding of LHX3 (LIM homeobox 3) to FSHB promoter/response element and down-regulation of FSHB transcription in gonadotrophs.
23504007 Serum FSH levels are affected by the combination of genetic polymorphisms in FSHR and FSHB
23426431 activin-regulated transcription mediated by forkhead box L2 [review]
23423746 Data indicate that neither serum inhibin B nor follicle-stimulating hormone (FSH) is a suitable surrogate for determination of sperm concentration in a semen sample.
23380184 Ser680 genotype for FSHR is a factor of relative resistance to FSH stimulation resulting in slightly higher FSH serum levels, thus leading to a prolonged duration of the menstrual cycle.
23160221 Both estradiol and progesterone uniquely modulate basal and GnRH-stimulated gonadotropin promoters without affecting cell growth.
23118424 Phenotypic consequences of FSHB -211G-->T on the hypothalamic-pituitary-ovarian axis in women.
More...

AA Sequence

MKTLQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCT      1 - 70
FKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE                71 - 129
//

Text Mined References (80)

PMID Year Title
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25052309 2015 The FSHB -211G>T variant attenuates serum FSH levels in the supraphysiological gonadotropin setting of Klinefelter syndrome.
24718625 2014 Reproductive physiology in young men is cumulatively affected by FSH-action modulating genetic variants: FSHR -29G/A and c.2039 A/G, FSHB -211G/T.
23850305 2013 FSHB-211 and FSHR 2039 are associated with serum levels of follicle-stimulating hormone and antimüllerian hormone in healthy girls: a longitudinal cohort study.
23766128 2013 A human FSHB promoter SNP associated with low FSH levels in men impairs LHX3 binding and basal FSHB transcription.
23504007 2013 The combination of genetic variants of the FSHB and FSHR genes affects serum FSH in women of reproductive age.
23426431 2013 Mechanisms of activin-stimulated FSH synthesis: the story of a pig and a FOX.
23423746 2013 Lack of specificity of plasma concentrations of inhibin B and follicle-stimulating hormone for identification of azoospermic survivors of childhood cancer: a report from the St Jude lifetime cohort study.
23380184 2013 Polymorphisms in gonadotropin and gonadotropin receptor genes as markers of ovarian reserve and response in in vitro fertilization.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
More...