Property Summary

NCBI Gene PubMed Count 83
PubMed Score 431.24
PubTator Score 217.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
pituitary cancer -6.000 1.4e-05
psoriasis -1.500 2.1e-06

Gene RIF (34)

AA Sequence

MTALFLMSMLFGLTCGQAMSFCIPTEYTMHIERRECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQD      1 - 70
VCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSYLVGFSV       71 - 138
//

Text Mined References (84)

PMID Year Title