Property Summary

NCBI Gene PubMed Count 77
Grant Count 45
R01 Count 35
Funding $4,527,287.08
PubMed Score 424.01
PubTator Score 217.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
pituitary cancer -6.000 0.000
psoriasis -1.500 0.000

Gene RIF (28)

PMID Text
26170068 Findings defined the immune-derived functional TSHb splice variant that resided in the thyroid of patients with Hashimoto's thyroiditis (HT), which exerted the unique effects on the pathogenesis of the disease.
25950606 analysis of a single nucleotide substitution in TSHbeta related to clinical euthyroidism [family case report]
25781359 Higher TSH levels are associated with less favorable lipid levels in children
25185682 Serum TSH was associated with pulse wave velocity on population level when adjusted with age and sex.
25012771 In cases with isolated central congenital hypothyroidism and undetectably low TSH serum concentrations, a TSHbeta gene deletion should be considered
24595799 High Thyroid Stimulating Hormone levels are associated with papillary thyroid carcinoma.
24366283 Epistasis between single nucleotide polymorphisms within the TSHB and ADAMTS16 genes may increase the risk of premature ovarian failure in Korean women.
24086448 bTSH Induces IL-6 Protein and mRNA in Orbital Fibroblasts and Fibrocytes
23345094 The use of these age-specific reference intervals for TSH, especially in those over 70 years old, would result in the reclassification of many TSH results from "abnormal" to "normal" and avoid unnecessary treatment.
22752807 In Hashimoto's thyroiditis the hTSHbeta splice variant exists in human serum and dimerises with TSHalpha.
More...

AA Sequence

MTALFLMSMLFGLTCGQAMSFCIPTEYTMHIERRECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQD      1 - 70
VCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSYLVGFSV       71 - 138
//

Text Mined References (78)

PMID Year Title
26170068 2015 Functional human TSH? splice variant produced by plasma cell may be involved in the immunologic injury of thyroid in the patient with Hashimoto's thyroiditis.
25950606 2015 A TSH? Variant with Impaired Immunoreactivity but Intact Biological Activity and Its Clinical Implications.
25781359 2015 Association between serum thyroid-stimulating hormone levels and serum lipids in children and adolescents: a population-based study of german youth.
25185682 2014 Association of thyrotropin with arterial pulse wave velocity in young adults: the Cardiovascular Risk in Young Finns Study.
25012771 2014 A novel deletion in the thyrotropin Beta-subunit gene identified by array comparative genomic hybridization analysis causes central congenital hypothyroidism in a boy originating from Turkey.
24595799 2014 Thyroglobulin antibodies could be a potential predictive marker for papillary thyroid carcinoma.
24366283 2014 Epistasis between polymorphisms in TSHB and ADAMTS16 is associated with premature ovarian failure.
24086448 2013 Thyrotropin regulates IL-6 expression in CD34+ fibrocytes: clear delineation of its cAMP-independent actions.
23345094 2013 Age- and gender-specific TSH reference intervals in people with no obvious thyroid disease in Tayside, Scotland: the Thyroid Epidemiology, Audit, and Research Study (TEARS).
22752807 2012 A newly identified TSH? splice variant is involved in the pathology of Hashimoto's thyroiditis.
More...