Property Summary

NCBI Gene PubMed Count 156
PubMed Score 405.61
PubTator Score 245.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
lung cancer 5.300 9.4e-07
lung carcinoma 1.600 1.6e-18
osteosarcoma 1.429 6.7e-04
ovarian cancer 1.300 1.1e-09
pituitary cancer -2.300 2.3e-02
psoriasis -1.300 6.3e-06
spina bifida -1.979 2.3e-02

Synonym

Accession P01215
Symbols HCG
LHA
FSHA
GPHa
TSHA
GPHA1
CG-ALPHA

Gene

CGA

PDB

1HCN   1HRP   1QFW   1XUL   1FL7   1XWD   4AY9   4MQW   1DZ7   1E9J   1HD4  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (106)

AA Sequence

MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKT      1 - 70
MLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS                             71 - 116
//

Text Mined References (156)

PMID Year Title