Property Summary

NCBI Gene PubMed Count 151
Grant Count 356
R01 Count 174
Funding $47,578,711.28
PubMed Score 384.47
PubTator Score 245.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.429 0.001
lung cancer 5.700 0.000
lung carcinoma 1.600 0.000
spina bifida -1.979 0.023
ovarian cancer 1.300 0.000
pituitary cancer -2.300 0.023
psoriasis -1.300 0.000

Synonym

Accession P01215
Symbols HCG
LHA
FSHA
GPHa
TSHA
GPHA1
CG-ALPHA

Gene

CGA

PANTHER Protein Class (2)

PDB

1HCN   1HRP   1QFW   1XUL   1FL7   1XWD   4AY9   4MQW   1DZ7   1E9J   1HD4  

Gene RIF (102)

PMID Text
26505791 TBP attenuates Msx1-mediated glycoprotein hormone alpha transcriptional repression.
26279419 The present results have for the first time shown protective effects exerted by hCG on vascular endothelial function.
26191157 Human chorionic gonadotropin provides a mechanism to bridge embryo to endometrium through beta1,4-GalT.
25933205 the 5-aminoimidazole-4-carboxyamide ribonucleoside (AICAR)-induced activation of AMPK directly inhibited the expression of SREBP-2 and HMGCR and HMGCS, and suppressed the TSH-stimulated up-regulation of SREBP-2 in HepG2 cells.
25529346 Limitations in the process of transcription and translation inhibit recombinant human chorionic gonadotropin expression in CHO cells.
25403028 thyroid-stimulating hormone elevations can obviously be the initial finding in pseudohypoparathyroidism type Ib patients.
25185682 Serum TSH was associated with pulse wave velocity on population level when adjusted with age and sex.
25064170 This study showed a link between low maternal serum hCG levels and cryptorchidism in boys from uncomplicated pregnancy.
24753159 A protective effect of hCG against breast cancer may be associated with its growth inhibitory and differentiation induction function in breast cancer cells.
24723381 A single low TSH at baseline was associated with increased risk of hip fractures (adj HR 1.16, 95% CI 1.07-1.26, p < 0.001) but not major osteoporotic fractures (MOF, adj HR 1.06, 95% CI 0.99-1.12, p = 0.058) over a median follow-up of 7.5 years.
More...

AA Sequence

MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKT      1 - 70
MLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS                             71 - 116
//

Text Mined References (151)

PMID Year Title
26505791 2015 Msx1 homeodomain transcription factor and TATA-binding protein interact to repress the expression of the glycoprotein hormone ? subunit gene.
26279419 2015 Human Chorionic Gonadotropin Protects Vascular Endothelial Cells from Oxidative Stress by Apoptosis Inhibition, Cell Survival Signalling Activation and Mitochondrial Function Protection.
26191157 2015 HCG induces ?1,4-GalT I expression and promotes embryo implantation.
25933205 2015 AICAR-Induced Activation of AMPK Inhibits TSH/SREBP-2/HMGCR Pathway in Liver.
25529346 2015 Limitations in the process of transcription and translation inhibit recombinant human chorionic gonadotropin expression in CHO cells.
25403028 2015 TSH elevations as the first laboratory evidence for pseudohypoparathyroidism type Ib (PHP-Ib).
25185682 2014 Association of thyrotropin with arterial pulse wave velocity in young adults: the Cardiovascular Risk in Young Finns Study.
25064170 2014 Association between altered placental human chorionic gonadotrophin (hCG) production and the occurrence of cryptorchidism: a retrospective study.
24753159 2014 Human chorionic gonadotropin decreases human breast cancer cell proliferation and promotes differentiation.
24723381 2014 Low serum thyrotropin level and duration of suppression as a predictor of major osteoporotic fractures-the OPENTHYRO register cohort.
More...