Property Summary

NCBI Gene PubMed Count 88
Grant Count 727
R01 Count 428
Funding $92,428,060.99
PubMed Score 2966.26
PubTator Score 567.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
ependymoma -1.500 0.005
astrocytoma -2.000 0.000
glioblastoma multiforme -2.000 0.000
oligodendroglioma -2.100 0.000
medulloblastoma -2.000 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma, large-cell -1.800 0.014
primitive neuroectodermal tumor -1.400 0.036
pediatric high grade glioma -1.300 0.003
pilocytic astrocytoma -1.400 0.000
psoriasis -1.400 0.000

Synonym

Accession P01213 A8K0Q3
Symbols ADCA
PENKB
SCA23

Gene

PDB

2N2F  

Gene RIF (77)

PMID Text
27055013 The results demonstrate that DYN 1-17 and certain N-terminal fragments, produced in an inflamed environment, play an anti-inflammatory role by inhibiting NF-kappaB/p65 translocation.
26502829 This study found a significant haplotype-by-sex interaction, suggesting association with alcohol dependence in males but not females. The findings suggest that sex-dependent effects of PDYN variants in alcohol dependence are phenotype-specific.
26489614 PDYN gene promoter polymorphism might contribute to familial-risk temporal lobe epilepsy. (Review, meta-analysis)
26341936 Enhanced event-related potentials amplitudes suggest a hyper-active performance monitoring system in high PDYN expression individuals, and this might also be an indicator of a higher risk for internalizing disorders
26169942 This study generated the first mouse model for SCA23 and shown that mice expressing PDYN-R212W recapitulate many characteristics of the human phenotype of SCA23
25220237 REST represses PDYN expression in SH-SY5Y cells and the adult human brain and may have implications for mental health and brain/mental disorders.
25177835 Studied differential DNA-protein interactions of PDYN and OPRK1 SNPs significantly associated with alcohol dependence.
25048760 The present findings revealed a male-limited association between VNTR polymorphism and heroin dependence risk.
24587148 A genetic polymorphism of the endogenous opioid dynorphin modulates monetary reward anticipation in the corticostriatal loop.
24405578 This study demonistratedn that Neurocognitive and neuroinflammatory correlates of PDYN mRNA expression in the anterior cingulate in postmortem brain of HIV-infected subjects.
More...

AA Sequence

MAWQGLVLAACLLMFPSTTADCLSRCSLCAVKTQDGPKPINPLICSLQCQAALLPSEEWERCQSFLSFFT      1 - 70
PSTLGLNDKEDLGSKSVGEGPYSELAKLSGSFLKELEKSKFLPSISTKENTLSKSLEEKLRGLSDGFREG     71 - 140
AESELMRDAQLNDGAMETGTLYLAEEDPKEQVKRYGGFLRKYPKRSSEVAGEGDGDSMGHEDLYKRYGGF    141 - 210
LRRIRPKLKWDNQKRYGGFLRRQFKVVTRSQEDPNAYSGELFDA                              211 - 254
//

Text Mined References (90)

PMID Year Title
27055013 2016 Dynorphin 1-17 and Its N-Terminal Biotransformation Fragments Modulate Lipopolysaccharide-Stimulated Nuclear Factor-kappa B Nuclear Translocation, Interleukin-1beta and Tumor Necrosis Factor-alpha in Differentiated THP-1 Cells.
26502829 2015 Associations of prodynorphin sequence variation with alcohol dependence and related traits are phenotype-specific and sex-dependent.
26489614 2015 Prodynorphin gene promoter polymorphism and temporal lobe epilepsy: A meta-analysis.
26341936 2015 Event-related potentials in performance monitoring are influenced by the endogenous opioid system.
26169942 2015 Elevated mutant dynorphin A causes Purkinje cell loss and motor dysfunction in spinocerebellar ataxia type 23.
25220237 2014 PDYN, a gene implicated in brain/mental disorders, is targeted by REST in the adult human brain.
25177835 2014 A molecular prospective provides new insights into implication of PDYN and OPRK1 genes in alcohol dependence.
25048760 2014 Association between VNTR polymorphism in promoter region of prodynorphin (PDYN) gene and heroin dependence.
24811271 2014 Genome-wide SNP associations with rubella-specific cytokine responses in measles-mumps-rubella vaccine recipients.
24587148 2014 A genetic polymorphism of the endogenous opioid dynorphin modulates monetary reward anticipation in the corticostriatal loop.
More...