Property Summary

NCBI Gene PubMed Count 89
PubMed Score 3009.28
PubTator Score 567.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Vascular disease 319 3.052 1.5
Cardiovascular system disease 246 0.0 3.0
Disease Target Count Z-score Confidence
Opiate dependence 29 0.0 5.0
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytoma -2.000 1.0e-22
Astrocytoma, Pilocytic -1.300 3.9e-04
atypical teratoid / rhabdoid tumor -1.900 8.8e-07
ependymoma -1.500 5.2e-03
glioblastoma -1.300 4.9e-04
group 3 medulloblastoma -1.700 2.0e-02
medulloblastoma, large-cell -1.800 1.4e-02
oligodendroglioma -2.100 8.2e-17
pediatric high grade glioma -1.300 2.6e-03
primitive neuroectodermal tumor -1.400 3.6e-02
psoriasis -1.400 6.2e-07

Protein-protein Interaction (4)

Gene RIF (78)

AA Sequence

MAWQGLVLAACLLMFPSTTADCLSRCSLCAVKTQDGPKPINPLICSLQCQAALLPSEEWERCQSFLSFFT      1 - 70
PSTLGLNDKEDLGSKSVGEGPYSELAKLSGSFLKELEKSKFLPSISTKENTLSKSLEEKLRGLSDGFREG     71 - 140
AESELMRDAQLNDGAMETGTLYLAEEDPKEQVKRYGGFLRKYPKRSSEVAGEGDGDSMGHEDLYKRYGGF    141 - 210
LRRIRPKLKWDNQKRYGGFLRRQFKVVTRSQEDPNAYSGELFDA                              211 - 254
//

Text Mined References (91)

PMID Year Title