Property Summary

NCBI Gene PubMed Count 55
Grant Count 175
R01 Count 116
Funding $18,852,313.49
PubMed Score 1145.89
PubTator Score 304.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
posterior fossa group B ependymoma -3.500 0.000
oligodendroglioma -1.800 0.011
glioblastoma -2.600 0.000
group 3 medulloblastoma -4.100 0.000
cystic fibrosis 1.296 0.011
medulloblastoma, large-cell -3.100 0.000
Duchenne muscular dystrophy 1.962 0.000
juvenile dermatomyositis 2.181 0.000
adrenocortical adenoma -2.157 0.014
adrenocortical carcinoma -2.159 0.000
colon cancer -3.500 0.000
breast carcinoma -1.400 0.000
adult high grade glioma -2.200 0.002
pilocytic astrocytoma -2.900 0.000
aldosterone-producing adenoma -4.712 0.007
invasive ductal carcinoma -3.908 0.001
Gaucher disease type 3 -1.100 0.012

Synonym

Accession P01210 B2RC23 Q6FHC6 Q6FHE6
Symbols PE
PENK-A

Gene

PDB

5E33   5E3A   1PLW   1PLX   2LWC  

Gene RIF (33)

PMID Text
26634308 Nav1.7 deletion has profound effects on gene expression, leading to an upregulation of enkephalin precursor Penk mRNA and met-enkephalin protein in sensory neurons.
26218633 Serum PENK-A levels were not associated with all-cause mortality in patients with type 2 diabetes mellitus, and its association with cardiovascular mortality was strongly attenuated after accounting for all traditional risk factors.
26164485 The PENK polymorphism-and potentially opioid neurotransmission more generally-modulates functioning and structural integrity of brain regions.
25891176 BSP demonstrated that emodin, to a certain degree, affected the demethylation of tumor-suppressor genes P16, RASSF1A, and ppENK in the pancreatic cancer cell line PANC-1.
24937655 enhanced plasma proenkephalin A could be a useful, complementary tool to predict short- or long-term clinical outcome after severe traumatic brain injury.
24937654 increased plasma PENK-A levels are associated with disease severity and in-hospital mortality after acute intracerebral hemorrhage.
24496384 EPS led to the discovery of two novel immunomodulatory proteins, MFAP5 and PENK that when administered to mice subjected to endotoxemic shock, reversed the cytokine storm and provided a significant survival benefit
24289328 Promoter methylation of WIF1, PENK and NPY is associated with colorectal adenocarcinoma (CRC) diagnosis and can be used to CRC from other cancers.
23937196 Data from women undergoing hysterectomy for uterine fibroids suggest that uterine isthmian-cervical region exhibits nerve fibers expressing enkephalin (ENK); uterine fundus/corpus myoma pseudocapsules do not exhibit nerve fibers expressing ENK.
23395721 Peptide F is bound to white blood cells in the blood. Exercise alters Peptide F in the plasma and white blood cell blood fractions.
More...

AA Sequence

MARFLTLCTWLLLLGPGLLATVRAECSQDCATCSYRLVRPADINFLACVMECEGKLPSLKIWETCKELLQ      1 - 70
LSKPELPQDGTSTLRENSKPEESHLLAKRYGGFMKRYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFM     71 - 140
KKDAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRGLKRSPQLEDEAKELQKRY    141 - 210
GGFMRRVGRPEWWMDYQKRYGGFLKRFAEALPSDEEGESYSKEVPEMEKRYGGFMRF                 211 - 267
//

Text Mined References (56)

PMID Year Title
26634308 2015 Endogenous opioids contribute to insensitivity to pain in humans and mice lacking sodium channel Nav1.7.
26218633 2015 Serum Proenkephalin A Levels and Mortality After Long-Term Follow-Up in Patients with Type 2 Diabetes Mellitus (ZODIAC-32).
26164485 2015 Effects of an opioid (proenkephalin) polymorphism on neural response to errors in health and cocaine use disorder.
26029055 2015 Downregulation of the endogenous opioid peptides in the dorsal striatum of human alcoholics.
25891176 2015 Effects of emodin on the demethylation of tumor-suppressor genes in pancreatic cancer PANC-1 cells.
24961912 2014 A DNA hypermethylation profile reveals new potential biomarkers for prostate cancer diagnosis and prognosis.
24937655 2014 Prognostic value of neuropeptide proenkephalin A in patients with severe traumatic brain injury.
24937654 2014 Neuropeptide proenkephalin A is associated with in-hospital mortality in patients with acute intracerebral hemorrhage.
24727154 2014 Circulating levels of neuropeptide proenkephalin A predict outcome in patients with aneurysmal subarachnoid hemorrhage.
24496384 2014 Enriched protein screening of human bone marrow mesenchymal stromal cell secretions reveals MFAP5 and PENK as novel IL-10 modulators.
More...