Property Summary

NCBI Gene PubMed Count 56
PubMed Score 1158.32
PubTator Score 304.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adrenocortical adenoma -2.157 1.4e-02
adrenocortical carcinoma -2.159 2.7e-04
adult high grade glioma -2.200 1.5e-03
aldosterone-producing adenoma -4.712 6.5e-03
Astrocytoma, Pilocytic -2.900 1.4e-05
breast carcinoma -1.200 5.2e-03
colon cancer -3.500 5.9e-07
cystic fibrosis 1.296 1.1e-02
Duchenne muscular dystrophy 1.962 1.6e-10
ependymoma -2.000 1.3e-02
Gaucher disease type 3 -1.100 1.2e-02
glioblastoma -2.400 5.7e-06
group 3 medulloblastoma -4.100 4.7e-06
invasive ductal carcinoma -3.908 1.4e-03
juvenile dermatomyositis 2.181 1.4e-10
medulloblastoma, large-cell -3.100 3.5e-05
oligodendroglioma -1.800 1.1e-02

Protein-protein Interaction (6)

Gene RIF (34)

AA Sequence

MARFLTLCTWLLLLGPGLLATVRAECSQDCATCSYRLVRPADINFLACVMECEGKLPSLKIWETCKELLQ      1 - 70
LSKPELPQDGTSTLRENSKPEESHLLAKRYGGFMKRYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFM     71 - 140
KKDAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRGLKRSPQLEDEAKELQKRY    141 - 210
GGFMRRVGRPEWWMDYQKRYGGFLKRFAEALPSDEEGESYSKEVPEMEKRYGGFMRF                 211 - 267
//

Text Mined References (57)

PMID Year Title