Property Summary

NCBI Gene PubMed Count 271
PubMed Score 36591.24
PubTator Score 11417.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Obesity 678 5.762 2.9
Hypertension 396 5.667 2.8
Hypokalemia 52 5.55 2.8
Epilepsy 792 5.117 2.6
diabetes mellitus 1728 4.71 2.4
Multiple Sclerosis 540 3.827 1.9
Osteoporosis 363 3.494 1.7
ACTH Syndrome, Ectopic 1 0.0 0.0
Adrenal Cortex Diseases 1 0.0 0.0
Amnesia 17 0.0 0.0
Aortic Stenosis, Subvalvular 1 0.0 0.0
Arthritis, Gouty 9 0.0 0.0
Autistic Disorder 364 0.0 0.0
Bipolar Disorder 666 0.0 0.0
Body Weight 14 0.0 0.0
Bradycardia 36 0.0 0.0
Burns 9 0.0 0.0
Calcinosis 70 0.0 0.0
Carcinoma, Renal Cell 124 0.0 0.0
Cardiomegaly 116 0.0 0.0
Cardiomyopathies 110 0.0 0.0
Cardiomyopathy, Hypertrophic 24 0.0 0.0
Catalepsy 15 0.0 0.0
Cerebral Hemorrhage 42 0.0 0.0
Cerebral palsy 40 0.0 0.0
Cholestasis 155 0.0 0.0
Chondrocalcinosis 9 0.0 0.0
Cocaine-Related Disorders 92 0.0 0.0
Constipation 181 0.0 0.0
Cushing Syndrome 3 0.0 0.0
Cystitis 15 0.0 0.0
Depressive disorder 409 0.0 0.0
Diabetes insipidus 18 0.0 0.0
Edema 81 0.0 0.0
Epilepsies, Myoclonic 32 0.0 0.0
Epilepsy, Tonic-Clonic 10 0.0 0.0
Eye Diseases 2 0.0 0.0
Eye pain 2 0.0 0.0
Facial paralysis 18 0.0 0.0
Fatty Liver 70 0.0 0.0
Femur Head Necrosis 3 0.0 0.0
Fever 138 0.0 0.0
Gastrointestinal Diseases 12 0.0 0.0
Glomerulonephritis 46 0.0 0.0
Heart failure 162 0.0 0.0
Hematuria 36 0.0 0.0
Hemorrhage 19 0.0 0.0
Heroin dependence 30 0.0 0.0
Hirsutism 47 0.0 0.0
Hypercalciuria 27 0.0 0.0
Hypernatremia 5 0.0 0.0
Hypocalcemia 32 0.0 0.0
Hypotension 82 0.0 0.0
Hypoxia 33 0.0 0.0
Immune System Diseases 4 0.0 0.0
Infection 6 0.0 0.0
Kidney Calculi 7 0.0 0.0
Kidney Diseases 114 0.0 0.0
Kidney Tubular Necrosis, Acute 4 0.0 0.0
Liver Cirrhosis, Experimental 769 0.0 0.0
Liver Failure, Acute 29 0.0 0.0
Long QT syndrome 39 0.0 0.0
Melanoma 711 0.0 0.0
Mental disorders 12 0.0 0.0
Myasthenia gravis 23 0.0 0.0
Myocardial Ischemia 169 0.0 0.0
Nausea 20 0.0 0.0
Necrosis 53 0.0 0.0
Nephrocalcinosis 35 0.0 0.0
Neurogenic Inflammation 12 0.0 0.0
Oliguria 8 0.0 0.0
Opsoclonus-Myoclonus Syndrome 1 0.0 0.0
Pain 103 0.0 0.0
Pancreatic Diseases 8 0.0 0.0
Penile Diseases 3 0.0 0.0
Pituitary ACTH Hypersecretion 3 0.0 0.0
Pneumonia 174 0.0 0.0
Postoperative Complications 4 0.0 0.0
Proopiomelanocortin Deficiency 1 0.0 0.0
Proteinuria 144 0.0 0.0
Recurrence 33 0.0 0.0
Restless legs syndrome 27 0.0 0.0
Rhabdomyoma 1 0.0 0.0
Sacroiliitis 1 0.0 0.0
Seizures 596 0.0 0.0
Sick sinus syndrome 15 0.0 0.0
Sleep Wake Disorders 7 0.0 0.0
Spasms, Infantile 6 0.0 0.0
Substance Withdrawal Syndrome 55 0.0 0.0
Synovitis 78 0.0 0.0
Urinary Tract Infections 2 0.0 0.0
Weight Gain 100 0.0 0.0
Weight Loss 24 0.0 0.0
Disease Target Count P-value
pituitary cancer 1972 1.2e-17
adult high grade glioma 3801 2.2e-03
breast carcinoma 1638 3.5e-03
Disease Target Count Z-score Confidence
Cushing's syndrome 48 8.659 4.0
Adenoma 167 7.019 3.5
Pituitary adenoma 38 6.918 3.5
Nelson syndrome 6 6.834 3.4
Congenital adrenal hyperplasia 73 6.591 3.3
Hypopituitarism 40 6.566 3.3
Addison's disease 31 6.367 3.2
Hypoglycemia 152 6.061 3.0
Pain agnosia 104 6.018 3.0
Kidney disease 430 5.765 2.9
Conn's syndrome 22 5.734 2.9
Adrenal cortical adenoma 19 5.568 2.8
Amenorrhea 58 5.359 2.7
Hyperaldosteronism 35 5.332 2.7
Hyperprolactinemia 27 5.236 2.6
Primary pigmented nodular adrenocortical disease 13 5.231 2.6
triple-A syndrome 17 5.153 2.6
Cancer 2499 5.111 2.6
Hyperandrogenism 34 5.106 2.6
Hypothyroidism 122 5.041 2.5
Polycystic ovary syndrome 360 4.957 2.5
Pituitary apoplexy 3 4.917 2.5
Acromegaly 51 4.877 2.4
Anxiety disorder 23 4.737 2.4
Hypogonadism 173 4.631 2.3
Rheumatic fever 19 4.631 2.3
Achalasia 13 4.57 2.3
Anorexia nervosa 80 4.469 2.2
Alcohol dependence 107 4.415 2.2
Major Depressive Disorder 301 4.408 2.2
Asthma 385 4.378 2.2
Arthritis 290 4.353 2.2
Hypersensitivity reaction type II disease 253 4.314 2.2
tuberculosis 2010 4.307 2.2
Hyperglycemia 137 4.234 2.1
Craniopharyngioma 16 4.182 2.1
Neurohypophyseal diabetes insipidus 13 4.074 2.0
Carney complex 25 4.006 2.0
Hypothalamic disease 3 3.982 2.0
Empty sella syndrome 6 3.965 2.0
Adrenoleukodystrophy 29 3.956 2.0
Myopathy 185 3.807 1.9
Neuropathy 261 3.77 1.9
Pseudohermaphroditism 16 3.767 1.9
Inappropriate ADH syndrome 5 3.749 1.9
Melancholia 10 3.73 1.9
Hyperthyroidism 53 3.726 1.9
X-linked adrenal hypoplasia congenita 11 3.655 1.8
Infertility 188 3.626 1.8
Withdrawal disorder 19 3.624 1.8
Substance abuse 59 3.6 1.8
Hyperinsulinism 133 3.557 1.8
Septooptic dysplasia 19 3.541 1.8
Dermatitis 157 3.525 1.8
Amnestic disorder 35 3.511 1.8
Tuberous sclerosis 19 3.495 1.7
Chronic fatigue syndrome 25 3.488 1.7
Schizophrenia 1160 3.467 1.7
Leydig cell tumor 9 3.437 1.7
Lung disease 142 3.403 1.7
Phaeochromocytoma 20 3.374 1.7
Trichinosis 7 3.351 1.7
Alopecia 115 3.285 1.6
Heart disease 306 3.277 1.6
McCune Albright syndrome 19 3.234 1.6
Gynecomastia 64 3.221 1.6
Congenital adrenal insufficiency 7 3.207 1.6
Drug dependence 3 3.159 1.6
Cerebrovascular disease 238 3.131 1.6
Thyroiditis 29 3.129 1.6
Bronchus adenoma 1 3.128 1.6
Allergic hypersensitivity disease 126 3.124 1.6
Inflammatory bowel disease 151 3.116 1.6
Hypertrichosis 46 3.073 1.5
Eye disease 62 3.059 1.5
Thyrotoxicosis 38 3.059 1.5
Meningitis 67 3.055 1.5
Motion sickness 21 3.054 1.5
Liver disease 237 3.053 1.5
Migraine 83 3.049 1.5
Adrenal rest tumor 5 3.036 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
adult high grade glioma -1.100 2.2e-03
breast carcinoma -1.100 3.5e-03
pituitary cancer -8.000 1.2e-17

Protein-protein Interaction (11)

Gene RIF (215)

AA Sequence

MPRSCCSRSGALLLALLLQASMEVRGWCLESSQCQDLTTESNLLECIRACKPDLSAETPMFPGNGDEQPL      1 - 70
TENPRKYVMGHFRWDRFGRRNSSSSGSSGAGQKREDVSAGEDCGPLPEGGPEPRSDGAKPGPREGKRSYS     71 - 140
MEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEFKRELTGQRLREGDGPDGPADDGAGAQADLEHSLL    141 - 210
VAAEKKDEGPYRMEHFRWGSPPKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE                 211 - 267
//

Text Mined References (271)

PMID Year Title