Property Summary

NCBI Gene PubMed Count 242
PubMed Score 8381.18
PubTator Score 8222.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Neurohypophyseal diabetes insipidus 13 7.344 3.7

Expression

Gene RIF (180)

AA Sequence

MPDTMLPACFLGLLAFSSACYFQNCPRGGKRAMSDLELRQCLPCGPGGKGRCFGPSICCADELGCFVGTA      1 - 70
EALRCQEENYLPSPCQSGQKACGSGGRCAAFGVCCNDESCVTEPECREGFHRRARASDRSNATQLDGPAG     71 - 140
ALLLRLVQLAGAPEPFEPAQPDAY                                                  141 - 164
//

Text Mined References (245)

PMID Year Title