Property Summary

NCBI Gene PubMed Count 211
Grant Count 1,049
R01 Count 547
Funding $147,847,368.24
PubMed Score 8071.15
PubTator Score 8222.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (57)

Expression

Synonym

Accession P01185 A0AV35 O14935
Symbols VP
ADH
ARVP
AVRP
AVP-NPII

Gene

AVP

Gene RIF (149)

PMID Text
26641207 There was no significant difference in serum copeptin between patients with vasovagal syncope, epilepsy, and controls.
26345979 This study evaluated the relationships among copeptin, ischemia-modified albumin (IMA), and extent of myocardial injury in patients with acute carbon monoxide poisoning.
26341999 This analysis is the first to show a consistent early increase in copeptin at first medical contact in the ambulance and a decrease to routine values within 12-36 h in patients presenting early with spontaneous acute myocardial infarction.
26321369 Data from a population in Sweden suggest association between elevated copeptin plasma levels at time of diagnosis of type 2 diabetes and later development (within 10-12 years) of renal insufficiency and progression to chronic kidney disease stage 3.
26295806 Higher acute vulnerability to stress exists in persons with long AVPR1A RS3 alleles and increased arginine vasopressin levels.
26286191 Copeptin did not vary significantly in complicated vs. uncomplicated community acquired pediatric pneumonia.
26233932 we examined a three-generation Cypriot kindred suspected to have familiar neurohypophyseal diabetes insipidus. Direct sequencing analysis of AVP-NPII identified a missense mutation within the AVP moiety on exon 1 of the gene in all affected family members
26201002 Low serum sodium was associated with an increased risk of cardiovascular and all-cause mortality in type 2 diabetes, but association was not explained by copeptin.
26200852 Findings provide evidence for AVP as a blood-based biomarker of social functioning in children with autism spectrum disorder (ASD), and a promising therapeutic target for ASD in children.
26200092 Data show that silencing of G protein-coupled estrogen receptor-1 (GPER) expression blocks the inhibitory effect of raloxifene on arginine vasopressin (AVP) mRNA levels in SH-SY5Y neuroblastoma cells.
More...

AA Sequence

MPDTMLPACFLGLLAFSSACYFQNCPRGGKRAMSDLELRQCLPCGPGGKGRCFGPSICCADELGCFVGTA      1 - 70
EALRCQEENYLPSPCQSGQKACGSGGRCAAFGVCCNDESCVTEPECREGFHRRARASDRSNATQLDGPAG     71 - 140
ALLLRLVQLAGAPEPFEPAQPDAY                                                  141 - 164
//

Text Mined References (213)

PMID Year Title
26641207 2016 Assessment of endothelin and copeptin as biomarkers for vasovagal syncope.
26345979 2015 Correlations among copeptin, ischemia-modified albumin, and the extent of myocardial injury in patients with acute carbon monoxide poisoning.
26341999 2015 Temporal release pattern of copeptin and troponin T in patients with suspected acute coronary syndrome and spontaneous acute myocardial infarction.
26321369 Association between copeptin and declining glomerular filtration rate in people with newly diagnosed diabetes. The Skaraborg Diabetes Register.
26295806 2015 Impact of Childhood Adversity and Vasopressin receptor 1a Variation on Social Interaction in Adulthood: A Cross-Sectional Study.
26286191 2015 Proadrenomedullin and copeptin in pediatric pneumonia: a prospective diagnostic accuracy study.
26233932 Identification of an AVP-NPII mutation within the AVP moiety in a family with neurohypophyseal diabetes insipidus: review of the literature.
26201002 2015 Is the association of serum sodium with mortality in patients with type 2 diabetes explained by copeptin or NT-proBNP? (ZODIAC-46).
26200852 2015 Arginine Vasopressin Is a Blood-Based Biomarker of Social Functioning in Children with Autism.
26200092 2015 The Selective Estrogen Receptor Modulator Raloxifene Regulates Arginine-Vasopressin Gene Expression in Human Female Neuroblastoma Cells Through G Protein-Coupled Estrogen Receptor and ERK Signaling.
More...