Property Summary

NCBI Gene PubMed Count 124
Grant Count 1,217
R01 Count 562
Funding $220,865,806.73
PubMed Score 14677.38
PubTator Score 2344.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (71)

Disease Z-score Confidence
Pain agnosia 99 6.867 3.4
Autistic Disorder 320 6.353 3.2
Diabetes insipidus 14 5.602 2.8
Chorioamnionitis 15 5.552 2.8
Neonatal jaundice 15 5.393 2.7
Endometritis 21 5.364 2.7
Postpartum depression 9 5.18 2.6
Anxiety disorder 22 5.068 2.5
Schizophrenia 501 5.001 2.5
Uterine inversion 5 4.965 2.5
Borderline personality disorder 12 4.737 2.4
Placental abruption 15 4.6 2.3
Hypertension 287 4.593 2.3
Placenta praevia 9 4.356 2.2
Asphyxia neonatorum 9 4.256 2.1
Morphine dependence 19 4.229 2.1
Placenta accreta 6 4.191 2.1
Oligohydramnios 18 4.107 2.1
Premature ejaculation 16 4.092 2.0
Bilirubin metabolic disorder 39 4.025 2.0
Prader-Willi syndrome 45 4.016 2.0
Neurohypophyseal diabetes insipidus 13 4.004 2.0
Meconium aspiration syndrome 4 3.966 2.0
Mastitis 48 3.936 2.0
Obesity 616 3.915 2.0
Placental insufficiency 13 3.859 1.9
Sexual dysfunction 10 3.833 1.9
Anorexia nervosa 59 3.802 1.9
chronic kidney disease 90 3.721 1.9
Asperger syndrome 35 3.629 1.8
Diarrhea 155 3.628 1.8
Hypoglycemia 81 3.627 1.8
Inhibited male orgasm 1 3.496 1.7
diabetes mellitus 1,663 3.394 1.7
Myoma 12 3.349 1.7
Amenorrhea 60 3.3 1.6
Amnestic disorder 37 3.247 1.6
Hypoactive sexual desire disorder 9 3.152 1.6
Bulimia nervosa 15 3.122 1.6
Infertility 163 3.107 1.6
Ectopic pregnancy 16 3.025 1.5
Anxiety Disorders 37
Colonic Neoplasms 126
Comatose 4
Disseminated intravascular coagulation 32
Dysmenorrhea 19
Edema 38
Fetal Death 4
Fetal Distress 1
Flushing 5
Headache 5
Hyperactive behavior 31
Hypertensive disease 193
Hyponatremia 6
Hypotension 53
Inflammation 109
Ischemia 27
Mammary Neoplasms, Experimental 150
Muscle Hypertonia 1
Pain 70
Polyuria 6
Prostatic Diseases 1
Seizures 95
Spasm 2
Taste Disorders 2
Tonic-clonic epilepsy 47
Water Intoxication 2
Weight Gain 87
Weight decreased 18
osteosarcoma 7,933
psoriasis 6,685

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.113 0.002
psoriasis -1.300 0.000

Synonym

Accession P01178 Q3MIG0 OT-NPI
Symbols OT
OT-NPI
OXT-NPI

Gene

OXT

Gene RIF (104)

PMID Text
26168929 Oxytocin serum levels with Attention Deficit Hyperactivity Disorder were significantly decreased compared with controls.
25451977 Oxytocin activates NF-kappaB-mediated inflammatory pathways in human gestational tissues in normal parturition.
25088178 reviews the role of OT in the control mechanisms of sexual behavior.
24768649 findings suggest that experiences of childhood emotional maltreatment may alter salivary oxytocin levels, which in turn are related to more positive perceptions of infant stimuli with positive emotion
24635660 nominal associations were found between autism spectrum disorder scores and single-nucleotide polymorphisms in OXT, ARNT2 and CD38
24412107 Patients with poor outcome after aneurysmal subarachnoid hemorrhage have lower AVP and OXT levels in cerebrospinal fluid.
24086383 dysregulation of OXT, AVP and/or testosterone systems exist in mothers of autistic children.
23941164 OXT rs2740210 interacted with early life adversity to predict variation in breastfeeding duration and postpartum depression.
23937196 Data from women undergoing hysterectomy for uterine fibroids suggest that uterine isthmian-cervical myoma pseudocapsules exhibit substantial nerve fibers expressing OXT; uterine fundal myoma pseudocapsules exhibit few nerve fibers expressing OXT.
23856187 Oxytocin plays an important role in modulation of social bonding processes and stress regulation, and may be crucially involved in the promotion of mental health. Review.
More...

AA Sequence

MAGPSLACCLLGLLALTSACYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTA      1 - 70
EALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR                    71 - 125
//

Text Mined References (124)

PMID Year Title
26168929 2015 Decreased levels of serum oxytocin in pediatric patients with Attention Deficit/Hyperactivity Disorder.
25451977 2015 Oxytocin activates NF-?B-mediated inflammatory pathways in human gestational tissues.
25088178 2015 The role of oxytocin in male and female reproductive behavior.
24768649 2014 Salivary oxytocin mediates the association between emotional maltreatment and responses to emotional infant faces.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24635660 2014 Associations between oxytocin-related genes and autistic-like traits.
24412107 2014 Vasopressin and oxytocin in CSF and plasma of patients with aneurysmal subarachnoid haemorrhage.
24086383 2013 Mothers of autistic children: lower plasma levels of oxytocin and Arg-vasopressin and a higher level of testosterone.
23941164 2013 Genetic variation in oxytocin rs2740210 and early adversity associated with postpartum depression and breastfeeding duration.
23937196 2013 The opioid neuropeptides in uterine fibroid pseudocapsules: a putative association with cervical integrity in human reproduction.
More...