Property Summary

NCBI Gene PubMed Count 229
Grant Count 229
R01 Count 153
Funding $23,013,323.75
PubMed Score 1719.78
PubTator Score 1992.28

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P01160 Q13766 Q5JZE1
Symbols ANF
ANP
CDD
CDP
PND
ATFB6
ATRST2
CDD-ANF

Gene

PANTHER Protein Class (2)

PDB

1ANP   1YK0   3N57  

Gene RIF (206)

PMID Text
26801306 ANP levels rose steeply after paroxysmal supraventricular tachycardia and then reduced at 30 min after the termination.
26720342 C2238/alphaANP downregulates ApoE in vascular smooth muscle cells through type C natriuretic peptide receptor-dependent activation of Egr-1 and the consequent upregulation of miR199a.
26686590 Gene polymorphism of ANP (2238T>C) may be associated with developing preeclampsia during pregnancy.
26616294 anti-inflammatory and immunomodulatory effect on IL-1beta release and on NF-kB/NALP3/caspase-1 activation
26499263 Age-related elevation of plasma ANP levels preceded the development of CKD in the general population of Japan, raising a possibility for ANP being involved in the development of CKD.
26244664 N-terminal pro-brain natriuretic
26200358 prevalence of p.(Ser64Arg) mutation is low in the general population as is the prevalence of atrial fibrillation in mutation carriers
26074089 In this review, we discuss the role of ANP in cardiovascular biology and disease.
25917967 Our results suggest that the down-regulation of ANP gene expression at mRNA and protein levels and up-regulated CYP11B2 protein expression levels may be correlated with the essential hypertension
25864764 ANP is present in chondrocytes in all the three zones of the articular cartilage, sugesting that ANP may play a role in cartilage metabolism.
More...

AA Sequence

MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEA      1 - 70
GAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDRIGA     71 - 140
QSGLGCNSFRYRR                                                             141 - 153
//

Text Mined References (230)

PMID Year Title
26801306 2016 Responses of cardiac natriuretic peptides after paroxysmal supraventricular tachycardia: ANP surges faster than BNP and CNP.
26720342 2015 C2238/?ANP modulates apolipoprotein E through Egr-1/miR199a in vascular smooth muscle cells in vitro.
26686590 2016 Analysis of the gene polymorphism of aldosterone synthase (CYP11B2) and atrial natriuretic peptide (ANP) in women with preeclampsia.
26616294 2016 Atrial natriuretic peptide down-regulates LPS/ATP-mediated IL-1? release by inhibiting NF-kB, NLRP3 inflammasome and caspase-1 activation in THP-1 cells.
26499263 2015 Plasma levels of natriuretic peptides and development of chronic kidney disease.
26244664 2015 Diagnostic Accuracy of Natriuretic Peptides for Heart Failure in Patients with Pleural Effusion: A Systematic Review and Updated Meta-Analysis.
26200358 2016 Atrial fibrillation and NPPA gene p.S64R mutation: are cardiologists helpless spectators of healthy mutation carriers?
26074089 2015 Atrial natriuretic peptide in cardiovascular biology and disease (NPPA).
25917967 2015 Atrial natriuretic peptide and aldosterone synthase gene in essential hypertension: a case-control study.
25864764 Atrial natriuretic Peptide expression in human articular cartilage.
More...