Property Summary

Ligand Count 11
NCBI Gene PubMed Count 244
PubMed Score 1788.90
PubTator Score 1992.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Cardiomyopathy 116 0.0 4.0
Familial atrial fibrillation 23 0.0 4.0

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.500 2.8e-08
ependymoma -1.100 1.2e-07
glioblastoma -1.200 5.4e-04
group 4 medulloblastoma -1.100 7.8e-04
medulloblastoma, large-cell -1.100 3.3e-03
non diabetic and post-ischemic heart fai... 3.000 1.4e-03
ovarian cancer -1.200 1.0e-05
type II diabetes mellitus and post-ische... 3.400 8.5e-06

Gene RIF (220)

AA Sequence

MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEA      1 - 70
GAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDRIGA     71 - 140
QSGLGCNSFRYRR                                                             141 - 153
//

Text Mined References (245)

PMID Year Title