Property Summary

NCBI Gene PubMed Count 117
PubMed Score 3724.81
PubTator Score 9261.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
Breast cancer 3098 2.8e-12
osteosarcoma 7933 5.0e-08
psoriasis 6685 1.1e-04
Disease Target Count Z-score Confidence
Klinefelter's syndrome 59 6.858 3.4
Kallmann Syndrome 33 0.0 4.0

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -2.000 1.1e-04
osteosarcoma -2.994 5.0e-08
Breast cancer -1.100 2.8e-12

Gene RIF (95)

PMID Text
26660506 GnRH regulates trophoblast invasion via RUNX2-mediated MMP2/MMP9 expression.
26644469 analysis of information transfer via gonadotropin-releasing hormone receptors to extracellular signal-regulated kinase or nuclear factor of activated T-cells
26595427 mutations in the region encoding the decapeptide associated with complete Idiopathic hypogonadotropic hypogonadism
26308290 Data suggest differences in regulation of expression of PEDF (up-regulation) vs. VEGF (down-regulation) in granulosa cells explain reduced risk of ovarian hyperstimulation syndrome due to ovulation induction using GnRH/GNRHR agonists rather than hCG.
25955300 our results showed that GnRH participates in the self-renewal capacity and stemness maintenance of LCSLCs by upregulating the JNK signaling pathway, and GnRH may be useful as an alternative lung cancer stem-like cells therapy.
25916694 Melatonin affects the secretion of GnRH, LH and testosterone, improves sperm quality thereby regulating the testicular development and male reproduction. (Review)
25248098 Haploinsufficiency of Dmxl2, encoding a synaptic protein, causes infertility associated with a loss of GnRH neurons in humans and mice.
24722580 GnRH agonists fail to increase Bax expression and do not potentiate the cytotoxic activity of docetaxel
24603682 Data indicate that the gene expression pattern is profoundly different between human chorionic gonadotropin (hCG) and gonadotropin-releasing hormone (GnRH) agonist.
24472523 GnRH, through heterotopic expression of its receptor, may be a potential regulator of CYP11B2 expression levels in some cases of aldosterone-producing adenoma.
24264576 GPR101 is a critical requirement for GnRH-(1-5) transactivation of EGFR in Ishikawa cells.
24095645 This review will summarize the current understanding of the mechanisms by which PACAP modulates gonadotrope function, with a focus on interactions with GnRH.
24056171 Current research efforts aim to discover the mechanisms responsible for the decoding of the GnRH pulse signal by the gonadotrope.
24010162 TRH, LH-RH and substance P are not affected in Alzheimer disease and Down's syndrome
24002956 No abnormalities were found in the patient group for the PROKR2 and GNRH1genes. In addition, no genomic rearrangements were identified in the healthy control individuals for the described genes
23936060 R31C GNRH1 is the only missense mutation that was identified in a CpG islet in nine congenital hypogonadotropic hypogonadism subjects from four unrelated families, giving evidence for a putative ''hot spot''.
23735672 This review summarizes the mechanisms used by glial cells to control GnRH neuronal ativity and secretion.
23648337 AXL and MET crosstalk to promote gonadotropin releasing hormone (GnRH) neuronal cell migration and survival.
23550012 Kisspeptin and GnRH pulse generation.
23550003 Kisspeptin resets the GnRH pulse generator in men, but does not appear to do so in women
23404564 Olfactory ensheathing cells form a microenvironment for migrating GnRH-1 neurons during development.
23287110 GnRHI, GnRHII and GnRH receptor expression correlated significantly with poor prognosis in breast cancer patients
23077052 Spontaneous GnRH release is detected in the median eminence of transgenic mice that produce diurnal variations in GnRH.
22161498 The role of several class 1 cytokines in regulating GnRH neuronal development, GnRH secretion, and GnRH expression in this REVIEW.
22074952 data demonstrate that GnRH transcription is repressed by AR via multiple sequences in GnRH-P, including three Oct-1 binding sites, and that this repression requires the complex interaction of several transcription factors
22024993 molecular mechanisms involved in GnRH/GnRHR signaling at the maternal-fetal interface. [Review]
21855365 [review] Existing evidence suggests that neural pathways originating in hindbrain and hypothalamic feeding nuclei transmit information concerning glucose availability to GnRH neurons, which integrate numerous physiological signals and metabolic cues.
21827674 Assessment of CGB and GNRH1 expression level in cancer patients' blood may be useful for indicating metastatic spread of tumor cells.
21722705 Mutations in GNRH1 have been associated with both mild and severe forms of GnRH deficiency, and may work in combination with other gene mutations to produce GnRH-deficient phenotypes.
21714833 Data show that higher levels of GnRH IgM antibodies were detected in patients with IBS and dysmotility, but not organic GI diseases, compared with healthy controls.
21646369 Sleep is associated with a significant decline in GnRH pulse frequency in both older and younger postmenopausal women
21368045 Deletion of the cell-specific enhancer region of GnRH implicates the GnRH promoter in mediating pubertal development and periodic reproductive cycling.
20951683 We then discuss possible neurobiological mechanisms underlying GnRH pulse generation, and conclude by proposing that kisspeptin neurons in the arcuate nucleus are key players--REVIEW
20887715 homozygous inactivating mutations in the GNRH1 gene causing hypothalamic hypogonadotropic hypogonadism in patients were reported, validating definitively the pivotal role of GnRH in human pubertal development and reproduction--REVIEW
20807514 The sources of glutamatergic inputs to the GnRH neurons are only just beginning to be examined and include the anteroventral periventricular nucleus as well as the possibility that GnRH neurons--REVIEW
20734064 Observational study of gene-disease association. (HuGE Navigator)
20727865 A large literature dealing with various stressors that regulate gonadotrophin-releasing hormone secretion in a variety of species provides evidence that stress modulates GnRH secretion by activating the corticotrophin-releasing factor system--REVIEW
20727862 Lactation is an important physiological model of the integration of energy balance and reproduction, as it involves activation of potent appetitive neuropeptide systems coupled to a profound inhibition of pulsatile GnRH/LH secretion--REVIEW
20634197 Meta-analysis of gene-disease association. (HuGE Navigator)
20529119 Data describe the distribution and sex dimorphism of kisspeptin-immunoreactive elements in hypothalami, reveal contacts between kisspeptin-immunoreactive fibers and GnRH cells, and colocalize kisspeptins and neurokinin B in the infundibular nucleus.
20484732 Review: Using human GnRH deficiency as a paradigm and presenting original data from the screening of numerous candidate genes, we discuss the emerging model of patient-focused clinical genetic research.
20424473 Observational study of gene-disease association. (HuGE Navigator)
20400076 The role of GnRH-GnRHR signaling at the maternal-fetal interface therefore appears to be limited to the regulation of trophoblast hCG production.
20389089 GNRH1 mutations might cause congenital idiopathic (or isolated) hypogonadotropic hypogonadism (Review)
20188792 The major genes associated with GnRH-dependent pubertal disorders, are reviewed.
20138117 Metabolic signals are integrated at the levels of first-order neurons equipped with the proper receptors, ant that these neurons send their signals towards hypothalamic GnRH neurons which constitute the integrative element of this network.
20118984 cadherin switching and p120(ctn) signaling as important targets of GnRH function and as novel mediators of invasiveness and tumor progression in ovarian cancer.
19849976 GNRH1 is mutated in people with familial hypogonadotropic hypogonadism.
19640273 Common variants of the GNRH1 and GNRHR genes are not associated with risk of invasive breast cancer in Caucasians
19640273 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19567835 GNRH1 mutations are a genetic cause of idiopathic hypogonadotropic hypogonadism.
19535795 identified a homozygous GNRH1 frameshift mutation in the sequence encoding the N-terminal region of the signal peptide-containing prepro-GnRH in a teenage brother & sister who had normosmic idiopathic hypogonadotropic hypogonadism
19489874 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19403562 Observational study of gene-disease association. (HuGE Navigator)
19190109 the antitumor effect of gonadotropin-releasing hormone type i is mediated by the activation of type I (but not of type II) GnRH-R
19086053 Observational study of gene-disease association. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18980792 Data show that over half of meningiomas may be regulated by GnRH-GnRH-R expression in an autocrine fashion.
18959739 summarize the current understanding of the antiproliferative actions of GnRH analogs, as well as the recent observations of GnRH effects on ovarian cancer cell apoptosis and motogenesis,and the molecular mechanisms that mediate GnRH actions
18959738 REVIEW: role of GnRH in the control of tumor growth, progression, and dissemination
18477660 GnRH-I and -II induce apoptosis in human granulosa cells through GnRH-I receptors, which mediate the proteolytic caspase cascade involving caspase-8 (the initiator) and caspase-3 and -7 (the effectors).
18467526 analysis of how GNRH I and GNRH II inhibit cell growth
18463157 12% of Kallman syndrome males have KAL1 deletions, but intragenic deletions of the FGFR1, GNRH1, GNRHR, GPR54 and NELF genes are uncommon in Idiopathic hypogonadotropic hypogonadism/Kallman syndrome.
17692113 Observational study of gene-disease association. (HuGE Navigator)
17680884 Data show that GnRH neurones morphologically interact with astrocytes and tanycytes in the human brain and suggest that glial cells may contribute to the process by which the neuroendocrine brain controls the function of GnRH neurones in humans.
17605472 Our data indicate a bridging interaction between Arg500 of the N-domain and Arg8 of GnRH that involves a chloride ion may account for its role in the specificity of the N-domain for endoproteolytic cleavage of the substrate at the NH2-terminus in vitro
17456575 estrogens may exert direct actions upon GnRH neurons exclusively through ER-beta
17220347 Observational study of gene-disease association. (HuGE Navigator)
17202595 we observed that LHRH-(1-5), the specific processed peptide of LHRH-I, upregulates LHRH-II mRNA expression in Ishikawa cells, an endometrial cell line but does not exert any influence on LHRH-I mRNA levels
16359986 GnRH1 gene is not responsible for idiopathic hypogonadotropic hypogonadism, at least as mutations are concerned
16157590 analysis of gonadotropin-releasing hormone ligand conformation and receptor selectivity
16061872 LHRH receptors are expressed in human RCC specimens
15809743 GnRH may protect ovarian cancer cells from stimulated apoptotic cell death.
15578334 GnRH-I induced greater proliferation in normal B-cells than IL-2 treatment alone.
15562029 Progesterone receptor isoform p4 is a potent regulator of GnRHRI at the transcriptional level as well as GnRH I mRNA.
15546906 Observational study of gene-disease association. (HuGE Navigator)
15546906 Genetic variation in GNRH1 is not likely to be a substantial modulator of pubertal timing in the general population.
15490304 Observational study of gene-disease association. (HuGE Navigator)
15283968 These galanin-LHRH and LHRH-galanin contacts may be functional synapses, and they may be the morphological substrate of the galanin-controlled gonadal functions in humans.
15229199 It is suggested that during the early to midfollicular phase the ovaries produce a gonadotrophin surge attenuating factor that antagonizes the pituitary-sensitizing effect of E2 to GnRH. (Gonadotrophin surge attenuating factor)
15138251 expression of the GnRH gene is regulated in neurons by TALE homeodomain proteins and Oct-1
15062568 In placental cytotrophoblasts, the upstream transcription start site of GnRH gene was the major one and gave rise to an mRNA level three times higher than the downstream start site. Estradiol downregulated GnRH gene expression in a dose-dependent fashion.
15001648 GnRH I and GnRH II have both common and discrete cellular distributions in the placenta and decidua and suggest that these two hormones are capable of eliciting their biological actions in an autocrine and/or paracrine manner
14726258 Experimental evidence indicates that GnRH-I is expressed, together with its receptors, in tumors of the reproductive tract. Activation of type I GnRH receptors consistently decreases cell proliferation, mainly by interfering with growth factors.
14594454 Review. The proliferation of human ovarian cancer cell lines is time- and dose-dependently reduced by GnRH and its superagonistic analogs.
14565958 Neurons respond to GnRH with time- and dose-dependent increases in GnRH gene expression and protein release.
12969578 gonadotropin releasing hormone-II is more effective than gonadotropin releasing hormone-I in stimulating leptin secretion
12788881 Genetic analysis has excluded sequence variations in GNRH1 and GNRHR in four families with recessive IHH, suggesting the existence of a novel, as-yet-undiscovered gene for this condition.
12770744 regulation of GnRH-I and GnRH-II gene expression in the ovary
12633791 Observational study of gene-disease association. (HuGE Navigator)
12447356 GnRH-II and GnRH-I interact directly with T cells and trigger gene transcription, adhesion, chemotaxis and homing to specific organs, which may be of clinical relevance.
12054733 JunD activated by LHRH acts as a modulator of cell proliferation and cooperates with the anti-apoptotic and anti-mitogenic functions of LHRH.
12040003 Coupling of GnRH concentration and the GnRH receptor-activated gene program
11875100 data indicate that the promoter region between -992 and -795 contains elements both essential and sufficient for targeting gene expression to GnRH neurons

AA Sequence

MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRS      1 - 70
PLRDLKGALESLIEEETGQKKI                                                     71 - 92
//

Text Mined References (117)

PMID Year Title
26660506 2016 GnRH regulates trophoblast invasion via RUNX2-mediated MMP2/9 expression.
26644469 2016 Information Transfer in Gonadotropin-releasing Hormone (GnRH) Signaling: EXTRACELLULAR SIGNAL-REGULATED KINASE (ERK)-MEDIATED FEEDBACK LOOPS CONTROL HORMONE SENSING.
26595427 2016 Complete Idiopathic Hypogonadotropic Hypogonadism due to Homozygous GNRH1 Mutations in the Mutational Hot Spots in the Region Encoding the Decapeptide.
26308290 2015 GnRH Agonist Triggering Modulates PEDF to VEGF Ratio Inversely to hCG in Granulosa Cells.
25955300 2015 GnRH participates in the self-renewal of A549-derived lung cancer stem-like cells through upregulation of the JNK signaling pathway.
25916694 2015 Melatonin and male reproduction.
25248098 2014 Haploinsufficiency of Dmxl2, encoding a synaptic protein, causes infertility associated with a loss of GnRH neurons in mouse.
24722580 2014 Gonadotropin-releasing hormone agonists sensitize, and resensitize, prostate cancer cells to docetaxel in a p53-dependent manner.
24603682 2014 GnRH agonist vs. hCG for triggering of ovulation--differential effects on gene expression in human granulosa cells.
24472523 2014 Aberrant gonadotropin-releasing hormone receptor (GnRHR) expression and its regulation of CYP11B2 expression and aldosterone production in adrenal aldosterone-producing adenoma (APA).
24264576 2014 GnRH-(1-5) transactivates EGFR in Ishikawa human endometrial cells via an orphan G protein-coupled receptor.
24095645 2014 PACAP modulates GnRH signaling in gonadotropes.
24056171 2014 GnRH pulse frequency-dependent differential regulation of LH and FSH gene expression.
24010162 1983 Thyrotropin-releasing hormone, luteinizing hormone-releasing hormone and substance P immuno-reactivity in post-mortem brain from cases of Alzheimer-type dementia and Down's syndrome.
24002956 2013 [Multiplex ligation dependent probe amplification analysis of KAL1, GNRH1, GNRHR, PROK2 and PROKR2 in male patients with idiopathic hypogonadotropic hypogonadism].
23936060 2013 R31C GNRH1 mutation and congenital hypogonadotropic hypogonadism.
23735672 2013 Role of glia in the regulation of gonadotropin-releasing hormone neuronal activity and secretion.
23648337 2013 AXL and MET crosstalk to promote gonadotropin releasing hormone (GnRH) neuronal cell migration and survival.
23643382 2013 Mutations in FGF17, IL17RD, DUSP6, SPRY4, and FLRT3 are identified in individuals with congenital hypogonadotropic hypogonadism.
23550012 2013 Kisspeptin and GnRH pulse generation.
23550003 2013 Effects of kisspeptin on hormone secretion in humans.
23404564 2013 Olfactory ensheathing cells form the microenvironment of migrating GnRH-1 neurons during mouse development.
23287110 2013 Gonadotropin-releasing hormone neuropeptides and receptor in human breast cancer: correlation to poor prognosis parameters.
23077052 2012 Fast scan cyclic voltammetry as a novel method for detection of real-time gonadotropin-releasing hormone release in mouse brain slices.
22161498 2012 Signaling of cytokines is important in regulation of GnRH neurons.
22074952 2012 Androgen receptor repression of GnRH gene transcription.
22024993 2011 Gonadotropin-releasing hormone/gonadotropin-releasing hormone receptor signaling in the placenta.
21855365 2011 Regulation of gonadotropin-releasing hormone neurons by glucose.
21827674 2011 CGB and GNRH1 expression analysis as a method of tumor cells metastatic spread detection in patients with gynecological malignances.
21722705 2011 A needle in a haystack: mutations in GNRH1 as a rare cause of isolated GnRH deficiency.
21714833 2011 Patients with irritable bowel syndrome and dysmotility express antibodies against gonadotropin-releasing hormone in serum.
21646369 2011 Persistence of sleep-associated decrease in GnRH pulse frequency in the absence of gonadal steroids.
21368045 2011 The gonadotropin-releasing hormone cell-specific element is required for normal puberty and estrous cyclicity.
20951683 2010 Neurobiological mechanisms underlying GnRH pulse generation by the hypothalamus.
20887715 2010 Genetics defects in GNRH1: a paradigm of hypothalamic congenital gonadotropin deficiency.
20807514 2010 Glutamate regulation of GnRH neuron excitability.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20727865 2010 Corticotrophin-releasing factor and stress-induced inhibition of the gonadotrophin-releasing hormone pulse generator in the female.
20727862 2010 The neuroendocrine basis of lactation-induced suppression of GnRH: role of kisspeptin and leptin.
20634197 2010 Comprehensive analysis of common genetic variation in 61 genes related to steroid hormone and insulin-like growth factor-I metabolism and breast cancer risk in the NCI breast and prostate cancer cohort consortium.
20529119 2010 The kisspeptin system of the human hypothalamus: sexual dimorphism and relationship with gonadotropin-releasing hormone and neurokinin B neurons.
20484732 2010 Deciphering genetic disease in the genomic era: the model of GnRH deficiency.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20400076 2010 Role of GnRH-GnRH receptor signaling at the maternal-fetal interface.
20389089 2010 Hypogonadotropic hypogonadism and GNRH1 mutations in mice and humans.
20188792 2010 Genetics basis for GnRH-dependent pubertal disorders in humans.
20138117 2010 Insulin and NPY pathways and the control of GnRH function and puberty onset.
20118984 2010 Cadherin switching and activation of p120 catenin signaling are mediators of gonadotropin-releasing hormone to promote tumor cell migration and invasion in ovarian cancer.
19849976 2009 [GNRH1 mutation in familial hypogonadotropic hypogonadism].
19640273 2009 Genetic polymorphisms of the GNRH1 and GNRHR genes and risk of breast cancer in the National Cancer Institute Breast and Prostate Cancer Cohort Consortium (BPC3).
19567835 2009 GNRH1 mutations in patients with idiopathic hypogonadotropic hypogonadism.
19535795 2009 Isolated familial hypogonadotropic hypogonadism and a GNRH1 mutation.
19489874 2010 Screening of autosomal gene deletions in patients with hypogonadotropic hypogonadism using multiplex ligation-dependent probe amplification: detection of a hemizygosis for the fibroblast growth factor receptor 1.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19403562 2009 Genetic polymorphisms of GnRH and gonadotrophic hormone receptors affect the phenotype of polycystic ovary syndrome.
19190109 2009 Type I gonadotropin-releasing hormone receptor mediates the antiproliferative effects of GnRH-II on prostate cancer cells.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
18980792 2009 Gonadotropin-releasing hormone (GnRH) and its receptor in human meningiomas.
18959739 2008 Gonadotropin-releasing hormone and ovarian cancer: a functional and mechanistic overview.
18959738 2008 Gonadotropin-releasing hormone: GnRH receptor signaling in extrapituitary tissues.
18477660 2008 Gonadotropin-releasing hormones I and II induce apoptosis in human granulosa cells.
18467526 2008 Gonadotropin-releasing hormone analog structural determinants of selectivity for inhibition of cell growth: support for the concept of ligand-induced selective signaling.
18463157 2008 The prevalence of intragenic deletions in patients with idiopathic hypogonadotropic hypogonadism and Kallmann syndrome.
17692113 2007 GnRH and LHR gene variants predict adverse outcome in premenopausal breast cancer patients.
17680884 2007 Morphological evidence for direct interaction between gonadotrophin-releasing hormone neurones and astroglial cells in the human hypothalamus.
17605472 2007 Simulated interactions between angiotensin-converting enzyme and substrate gonadotropin-releasing hormone: novel insights into domain selectivity.
17557168 2007 Characterization of the cDNAs encoding three GnRH forms in the pejerrey fish Odontesthes bonariensis (Atheriniformes) and the evolution of GnRH precursors.
17456575 2007 Gonadotropin-releasing hormone neurons express estrogen receptor-beta.
17220347 2007 Variant in sex hormone-binding globulin gene and the risk of prostate cancer.
17202595 2007 Regulation of type II luteinizing hormone-releasing hormone (LHRH-II) gene expression by the processed peptide of LHRH-I, LHRH-(1-5) in endometrial cells.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
16359986 2005 The gonadotropin-releasing hormone (GnRH)-1 gene, the GnRH receptor gene, and their promoters in patients with idiopathic hypogonadotropic hypogonadism with or without resistance to GnRH action.
16157590 2005 Evolution of constrained gonadotropin-releasing hormone ligand conformation and receptor selectivity.
16061872 2005 Receptors for luteinizing hormone releasing hormone expressed on human renal cell carcinomas can be used for targeted chemotherapy with cytotoxic luteinizing hormone releasing hormone analogues.
15809743 2005 Gonadotropin-releasing hormone retards doxorubicin-induced apoptosis and serine/threonine phosphatase inhibition in ovarian cancer cells.
15578334 2004 Expression of gonadotropin-releasing hormone type-I (GnRH-I) and type-II (GnRH-II) in human peripheral blood mononuclear cells (PMBCs) and regulation of B-lymphoblastoid cell proliferation by GnRH-I and GnRH-II.
15562029 2005 Differential role of progesterone receptor isoforms in the transcriptional regulation of human gonadotropin-releasing hormone I (GnRH I) receptor, GnRH I, and GnRH II.
15546906 2005 Determination of sequence variation and haplotype structure for the gonadotropin-releasing hormone (GnRH) and GnRH receptor genes: investigation of role in pubertal timing.
15490304 2004 Large-scale investigation of genomic markers for severe periodontitis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15283968 2004 Bi-directional associations between galanin and luteinizing hormone-releasing hormone neuronal systems in the human diencephalon.
15229199 2004 Changes in pituitary sensitivity to GnRH in estrogen-treated post-menopausal women: evidence that gonadotrophin surge attenuating factor plays a physiological role.
15138251 2004 TALE homeodomain proteins regulate gonadotropin-releasing hormone gene expression independently and via interactions with Oct-1.
15062568 2004 Estrogen down-regulates GnRH gene expression in human placental cytotrophoblast cells.
15001648 2004 Cellular localization of gonadotropin-releasing hormone (GnRH) I and GnRH II in first-trimester human placenta and decidua.
14726258 2003 The biology of gonadotropin hormone-releasing hormone: role in the control of tumor growth and progression in humans.
14594454 2003 Role of gonadotropin-releasing hormone (GnRH) in ovarian cancer.
14565958 2004 Expression and function of gonadotropin-releasing hormone (GnRH) receptor in human olfactory GnRH-secreting neurons: an autocrine GnRH loop underlies neuronal migration.
12969578 2003 Possible interactions between leptin, gonadotrophin-releasing hormone (GnRH-I and II) and human chorionic gonadotrophin (hCG).
12788881 2003 Autosomal recessive idiopathic hypogonadotropic hypogonadism: genetic analysis excludes mutations in the gonadotropin-releasing hormone (GnRH) and GnRH receptor genes.
12770744 2003 Multi-factorial role of GnRH-I and GnRH-II in the human ovary.
12633791 2003 Association of a Trp16Ser variation in the gonadotropin releasing hormone signal peptide with bone mineral density, revealed by SNP-dependent PCR typing.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12447356 2002 The neuropeptides GnRH-II and GnRH-I are produced by human T cells and trigger laminin receptor gene expression, adhesion, chemotaxis and homing to specific organs.
12054733 2002 Luteinizing hormone-releasing hormone induces JunD-DNA binding and extends cell cycle in human ovarian cancer cells.
12040003 2002 Coupling of GnRH concentration and the GnRH receptor-activated gene program.
11278902 2001 Marked differences between metalloproteases meprin A and B in substrate and peptide bond specificity.
10832105 2000 LHRH might act as a negative autocrine regulator of proliferation of human ovarian cancer.
10391209 1999 Characterization of single-nucleotide polymorphisms in coding regions of human genes.
9484912 1997 Gene expression of gonadotropin-releasing hormone, but not its receptor, in human endometrium and decidua.
9414473 1997 Advances in understanding gonadotrophin-releasing hormone receptor structure and ligand interactions.
9202214 1997 Characterization of multiple promoters directing tissue-specific expression of the human gonadotropin-releasing hormone gene.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8784072 1996 Gonadotropin-releasing hormone (GnRH) and GnRH receptor gene expression in human myometrium and leiomyomata and the direct action of GnRH analogs on myometrial smooth muscle cells and interaction with ovarian steroids in vitro.
8692981 1996 Cytotoxic analogs of luteinizing hormone-releasing hormone containing doxorubicin or 2-pyrrolinodoxorubicin, a derivative 500-1000 times more potent.
8529206 1995 Expression of gonadotropin-releasing hormone and gonadotropin-releasing hormone receptor mRNAs in various non-reproductive human tissues.
8145771 1993 Identification of a major up-stream transcription start site for the human progonadotropin-releasing hormone gene used in reproductive tissues and cell lines.
6760865 1982 The chemical identity of the immunoreactive LHRH-like peptide biosynthesized in the human placenta.
6090951 1984 Characterization of cDNA for precursor of human luteinizing hormone releasing hormone.
3511544 1986 Human luteinizing hormone-releasing hormone gene (LHRH) is located on short arm of chromosome 8 (region 8p11.2----p21).
2867548 1986 Isolation of the gene and hypothalamic cDNA for the common precursor of gonadotropin-releasing hormone and prolactin release-inhibiting factor in human and rat.
2863757 1985 A prolactin-inhibiting factor within the precursor for human gonadotropin-releasing hormone.
2671939 1989 The complete nucleotide sequence of the human gonadotropin-releasing hormone gene.
1767338 1991 The gonadotropin-releasing hormone (Gnrh) gene maps to mouse chromosome 14 and identifies a homologous region on human chromosome 8.
1682898 1991 NcoI RFLP of the human LHRH gene on chromosome 8p.
1310542 1992 Analogues of luteinizing hormone-releasing hormone containing cytotoxic groups.