Property Summary

NCBI Gene PubMed Count 121
PubMed Score 3826.46
PubTator Score 9261.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
Breast cancer 3578 2.8e-12
osteosarcoma 7950 5.0e-08
psoriasis 6694 1.1e-04
Disease Target Count Z-score Confidence
Kallmann syndrome 33 0.0 4.0
Klinefelter's syndrome 56 0.0 4.0

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer -1.100 2.8e-12
osteosarcoma -2.994 5.0e-08
psoriasis -2.000 1.1e-04

Protein-protein Interaction (9)

Gene RIF (99)

AA Sequence

MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRS      1 - 70
PLRDLKGALESLIEEETGQKKI                                                     71 - 92
//

Text Mined References (122)

PMID Year Title