Property Summary

NCBI Gene PubMed Count 283
PubMed Score 10626.83
PubTator Score 1198.40

Knowledge Summary


No data available


  Disease Sources (7)

Disease Target Count P-value
cystic fibrosis 1670 1.93472874983917E-6
Hydrolethalus syndrome 128 0.0433327328091429
Disease Target Count Z-score Confidence
Hereditary sensory neuropathy 6 0.0 5.0
Disease Target Count Z-score Confidence
Neuropathy 210 5.732 2.9
Neurodegenerative disease 383 0.0 4.0


  Differential Expression (2)

Disease log2 FC p
cystic fibrosis -1.520 0.000
Hydrolethalus syndrome 1.757 0.043


Accession P01138 A1A4E5 Q6FHA0 Q96P60 Q9P2Q8 Q9UKL8 Beta-NGF
Symbols NGFB




1WWW   2IFG   1SG1   4EDW   4EDX   4ZBN  

  Ortholog (9)

Species Source
Chimp OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid

Gene RIF (230)

27008247 Major depression patients had similar serum NGF to controls.
26962689 NGF FLIPs TrkA onto the death TRAIL in neuroblastoma cells
26616164 The present study showed that IL-17, in addition to stimulating an inflammatory response, negatively regulates the action of NGF and NGF R in the polar forms of the leprosy.
26572749 The present study is the first to thoroughly assess the enhancement of neural differentiation of bone marrow mesenchymal stem cells following transfection with bFGF and NGF.
26569118 NGF has a role in modulating trkANGFR/p75NTR in alphaSMA-expressing conjunctival fibroblasts from human ocular cicatricial pemphigoid
26547754 Intratumoral nerve growth factor expression is not associated with perineural invasion in patients with resected extrahepatic cholangiocarcinoma.
26457789 Data suggest MMP7 (matrix metalloproteinase 7) in follicular fluid cleaves proNGF (pro-nerve growth factor) in ovarian follicle; both MMP7 and proNGF appear to be products of granulosa cells; processing of proNGF to NGF appears to regulate apoptosis.
26408608 data demonstrate the involvement and modulation of nerve growth factor and its receptors in chronic obstructive pulmonary disease and in its staging
26337663 This study suggests that the circadian rhythm in the esophagus may be important for the mediation of and/or the response to erosive damage in GERD patients.
26118751 These results suggest that reduced NGF serum levels can be a possible biomarker of MDD.

AA Sequence

LTMDGKQAAWRFIRIDTACVCVLSRKAVRRA                                           211 - 241

Text Mined References (286)

PMID Year Title
27008247 2016 Elevated Brain-Derived Neurotrophic Factor Correlates Negatively with Severity and Duration of Major Depressive Episodes.
26962689 2016 NGF FLIPs TrkA onto the death TRAIL in neuroblastoma cells.
26616164 2016 Correlation between nerve growth factor and tissue expression of IL-17 in leprosy.
26572749 2016 Effects of nerve growth factor and basic fibroblast growth factor dual gene modification on rat bone marrow mesenchymal stem cell differentiation into neuron-like cells in vitro.
26569118 2015 NGF Modulates trkANGFR/p75NTR in ?SMA-Expressing Conjunctival Fibroblasts from Human Ocular Cicatricial Pemphigoid (OCP).
26547754 2016 Nerve Growth Factor Expression Is Not Associated with Perineural Invasion in Extrahepatic Cholangiocarcinoma.
26457789 2015 Pro-nerve growth factor in the ovary and human granulosa cells.
26408608 2016 A role for NGF and its receptors TrKA and p75NTR in the progression of COPD.
26337663 2015 Changes in Gene Expression Patterns of Circadian-Clock, Transient Receptor Potential Vanilloid-1 and Nerve Growth Factor in Inflamed Human Esophagus.
26118751 2015 Serum levels of nerve growth factor (NGF) in patients with major depression disorder and suicide risk.