Property Summary

Ligand Count 1
NCBI Gene PubMed Count 309
PubMed Score 10936.65
PubTator Score 1198.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (9)

Disease Target Count P-value
cystic fibrosis 1696 1.9e-06
Hydrolethalus syndrome 128 4.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
substance-related disorder 162 0.0 0.7
Disease Target Count Z-score Confidence
Hereditary sensory neuropathy 11 0.0 5.0
Disease Target Count Z-score Confidence
Neuropathy 261 5.785 2.9
Neurodegenerative disease 414 0.0 4.0

Expression

  Differential Expression (2)

Disease log2 FC p
cystic fibrosis -1.520 1.9e-06
Hydrolethalus syndrome 1.757 4.3e-02

Gene RIF (254)

AA Sequence

MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNI      1 - 70
TVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVS     71 - 140
VWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKA    141 - 210
LTMDGKQAAWRFIRIDTACVCVLSRKAVRRA                                           211 - 241
//

Text Mined References (312)

PMID Year Title