Property Summary

NCBI Gene PubMed Count 3,362
PubMed Score 20956.55
PubTator Score 14221.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Cleft palate 125
Myopathy 128
Oral Submucous Fibrosis 18
Acromicric Dysplasia 5
Acute Lung Injury 18
Acute kidney injury 65
Adenocarcinoma 115
Aortic valve insufficiency 22
Berylliosis 28
Camurati-Engelmann Syndrome 1
Carcinosarcoma 6
Cerebrovascular accident 44
Chronic Obstructive Airway Disease 47
Colorectal Cancer 62
Colorectal Neoplasms 217
Copper-Overload Cirrhosis 11
Diabetes Mellitus, Experimental 106
Diabetes Mellitus, Non-Insulin-Dependent 161
Diabetic Nephropathy 37
Diabetic Neuropathies 13
Diaphragmatic Hernia 40
Dry Eye Syndromes 2
Duodenal ulcer 20
Endomyocardial Fibrosis 10
Fibrosis 40
Focal glomerulosclerosis 22
Hepatitis, Autoimmune 17
Hepatitis, Chronic 22
Hyperplasia 26
Hypersensitivity 63
Hypertensive disease 193
IGA Glomerulonephritis 454
Inflammation 109
Intervertebral Disc Degeneration 5
Kidney Diseases 86
Kidney Failure, Chronic 45
Liver Cirrhosis 101
Liver Cirrhosis, Alcoholic 16
Liver Cirrhosis, Experimental 108
Liver carcinoma 217
Lung Neoplasms 171
Lung diseases 48
Migraine Disorders 26
Muscular Dystrophy, Duchenne 7
Myocardial Infarction 126
Neoplasm Invasiveness 127
Neoplasm Metastasis 138
Neoplastic Cell Transformation 81
Nephrotic Syndrome 48
Non-alcoholic Fatty Liver Disease 40
Osteoporosis, Postmenopausal 7
Pancreatic Neoplasm 79
Papilloma 27
Peritoneal Fibrosis 1
Peyronie Disease 1
Prostatic Neoplasms 471
Proteinuria 63
Pulmonary Fibrosis 66
Pulmonary emphysema 34
Sepsis 21
Skin Neoplasms 49
Spontaneous abortion 108
Squamous cell carcinoma 96
Thrombocythemia, Essential 12
Uremia 19
Ureteral obstruction 6
Urticaria 53
Ventricular Remodeling 5
Disease Target Count P-value
lung carcinoma 2844 6.65145688022861E-19
pilocytic astrocytoma 3086 5.85205043591271E-7
glioblastoma 5572 1.54444660680402E-5
pediatric high grade glioma 2712 1.63685185899138E-5
malignant mesothelioma 3163 5.99941567369382E-5
ulcerative colitis 2087 0.00144480254548802
atypical teratoid / rhabdoid tumor 4369 0.00201424470113403
pancreatic cancer 2300 0.00325209804189155
astrocytic glioma 2241 0.00374782525389127
primary pancreatic ductal adenocarcinoma 1271 0.00391406088456031
gastric carcinoma 832 0.00613424846904358
medulloblastoma 1524 0.0160682974718529
osteosarcoma 7933 0.0194354985174309
ependymoma 2514 0.0264920093806394
Disease Target Count Z-score Confidence
Cancer 2346 6.938 3.5
Kidney disease 397 6.682 3.3
Lung disease 136 6.055 3.0
Ureteral disease 23 5.741 2.9
Hypersensitivity reaction type II disease 235 5.524 2.8
Collagen disease 25 5.414 2.7
Liver disease 219 5.26 2.6
Arthritis 248 5.21 2.6
diabetes mellitus 1663 5.189 2.6
Hypertension 293 5.076 2.5
Hereditary hemorrhagic telangiectasia 14 4.927 2.5
Inflammatory bowel disease 142 4.916 2.5
Heart disease 279 4.735 2.4
Atherosclerosis 275 4.496 2.2
Loeys-Dietz syndrome 23 4.379 2.2
Multiple Sclerosis 498 4.331 2.2
Allergic hypersensitivity disease 123 4.294 2.1
Coronary artery disease 240 4.273 2.1
Peyronie's disease 8 4.259 2.1
Proliferative vitreoretinopathy 17 4.205 2.1
Leishmaniasis 49 4.134 2.1
Pancreatitis 97 4.007 2.0
Glaucoma 135 3.998 2.0
Hyperglycemia 120 3.93 2.0
Periodontal disease 37 3.921 2.0
tuberculosis 1563 3.905 2.0
Obesity 616 3.654 1.8
Dermatitis 141 3.639 1.8
Aortic aneurysm 34 3.631 1.8
Cerebrovascular disease 231 3.573 1.8
Hepatitis C 90 3.538 1.8
Cholestasis 93 3.454 1.7
Chronic fatigue syndrome 29 3.443 1.7
Peripheral vascular disease 90 3.385 1.7
Adenoma 165 3.358 1.7
Schistosomiasis 38 3.349 1.7
Diabetic Retinopathy 53 3.348 1.7
Allergic rhinitis 92 3.338 1.7
Human immunodeficiency virus infectious disease 129 3.333 1.7
Eosinophilia 65 3.328 1.7
Endometriosis 535 3.301 1.7
Hepatitis B 103 3.217 1.6
Portal hypertension 21 3.18 1.6
Common cold 63 3.176 1.6
Malaria 140 3.149 1.6
Retinal detachment 33 3.107 1.6
Marfan Syndrome 14 3.101 1.6
Neuropathy 210 3.095 1.5
Alzheimer's disease 644 3.089 1.5
Peritonitis 37 3.03 1.5
Corneal disease 32 3.024 1.5

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
astrocytic glioma 1.700 0.004
ependymoma 1.400 0.026
glioblastoma 2.800 0.000
osteosarcoma 1.297 0.019
atypical teratoid / rhabdoid tumor 1.200 0.002
medulloblastoma 1.300 0.016
primary pancreatic ductal adenocarcinoma 1.560 0.004
diabetes mellitus -1.700 0.006
pediatric high grade glioma 2.100 0.000
pilocytic astrocytoma 2.000 0.000
lung carcinoma -1.700 0.000
gastric carcinoma 1.600 0.006
ulcerative colitis 1.800 0.001
pancreatic cancer 1.500 0.003
See source...

Synonym

Accession P01137 A8K792 Q9UCG4 TGF-beta-1
Symbols CED
LAP
DPD1
TGFB
TGFbeta

Gene

PANTHER Protein Class (2)

PDB

3KFD   1KLA   1KLC   1KLD   4KV5  

  Ortholog (10)

 GWAS Trait (1)

Gene RIF (3473)

PMID Text
27534050 The maximum risk for Pulmonary tuberculosis is associated with a combination of the AA genotypes of the polymorphic site +874A/Tof the IFNG gene and TT polymorphism G509T of the TGFB gene (AA/TT).
27455564 The involvement of TGF-beta in pathogenesis of Marfan's syndrome permits considering ACE antagonists as potential pharmaceuticals in therapy for this disease. (Review)
27215961 Considering the low frequency of TGF-beta1 G allele at codon 25 as well as TGF-beta1 CT genotype at codon 10 in patients with juvenile idiopathic arthritis, it seems that these cytokine gene polymorphisms could play role as the protective factors against JIA.
27215079 distribution of the C/T polymorphism of TGFB1 between healthy individuals and patients were obtained as TT: 22.4%, TC: 46%, CC: 31.6%, and TT: 19.1%, TC: 48.3%, CC: 32.6%, respectively
27181170 Serum TGF-beta1 in patients with acute myocardial infarction.
27143355 The current study describes a novel mechanism linking the TSG-6 transfer of the newly described HC5 to the HA-dependent control of cell phenotype. The interaction of HC5 with cell surface HA was essential for TGFbeta1-dependent differentiation of fibroblasts to myofibroblasts, highlighting its importance as a novel potential therapeutic target.
27129231 TGF-beta1 may contribute to hepcidin synthesis during iron overload.
27100181 High TGFB1 expression is associated with Colon Adenomas.
27097224 Urine TGF-beta1 and collagen-IV were significantly higher in albuminuric compared to non-albuminuric participants with HIV infection
27093792 There was a trend to higher fibrosis progression rate in Chronic Hepatitis C patients with mutant alleles and genotypes of TGFb +915 G/C.
More...

AA Sequence

MPPSGLRLLLLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPP      1 - 70
GPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQSTHSIYMFFNTSEL     71 - 140
REAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSFDVTGVVRQWLSR    141 - 210
GGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRAL    211 - 280
DTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGA    281 - 350
SAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS                                  351 - 390
//

Text Mined References (3365)

PMID Year Title
27534050 2010 [ALLELE POLYMORPHISM OF THE IFNG AND TGFB GENES AS A FACTOR OF MODULATION OF CYTOKINE SECRETION AND SUSCEPTIBILITY TO PULMONARY TUBERCULOSIS].
27455564 2016 [THE ROLE OF TRANSFORMING GROWTH FACTOR-B IN IMMUNOPATHOGENESIS OF DISEASES OF CONNECTIVE TISSUE].
27215961 2016 Interleukin 10 and transforming growth factor beta 1 gene polymorphisms in juvenile idiopathic arthritis.
27215079 2016 Impact of TGF-?1 Gene Polymorphism (rs1800469) on Treatment Response to Pegylated Interferon/Ribavirin in Iranian Patients with Hepatitis C.
27181170 2016 Serum TGF-?1 in patients with acute myocardial infarction.
27143355 2016 Tumor Necrosis Factor-stimulated Gene 6 (TSG-6)-mediated Interactions with the Inter-?-inhibitor Heavy Chain 5 Facilitate Tumor Growth Factor ?1 (TGF?1)-dependent Fibroblast to Myofibroblast Differentiation.
27129231 2016 Transforming Growth Factor ?1 (TGF-?1) Activates Hepcidin mRNA Expression in Hepatocytes.
27100181 2016 Mutational Profiles Reveal an Aberrant TGF-?-CEA Regulated Pathway in Colon Adenomas.
27097224 2016 Elevation of Non-Classical (CD14+/lowCD16++) Monocytes Is Associated with Increased Albuminuria and Urine TGF-?1 in HIV-Infected Individuals on Stable Antiretroviral Therapy.
27093792 2015 [Mathematic Model for Prediction of Liver Fibrosis Progression Rate in Patients with Chronic Hepatitis C Based on Combination of Genomic Markers].
More...