Property Summary

Ligand Count 7
NCBI Gene PubMed Count 3,747
PubMed Score 5672.03
PubTator Score 14221.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Ureteral obstruction 33 5.209 2.6
Hypertension 396 4.583 2.3
Asthma 385 4.063 2.0
Osteoporosis 363 3.405 1.7
Abortion, Spontaneous 109 0.0 0.0
Acromicric Dysplasia 5 0.0 0.0
Acute Lung Injury 22 0.0 0.0
Acute kidney injury 70 0.0 0.0
Adenocarcinoma 122 0.0 0.0
Aortic Valve Insufficiency 40 0.0 0.0
Asthma, Occupational 10 0.0 0.0
Berylliosis 28 0.0 0.0
Calcinosis 70 0.0 0.0
Camurati-Engelmann Syndrome 5 0.0 0.0
Carcinoma 11493 0.0 0.0
Carcinoma, Hepatocellular 228 0.0 0.0
Carcinoma, Squamous Cell 110 0.0 0.0
Carcinosarcoma 7 0.0 0.0
Cell Transformation, Neoplastic 97 0.0 0.0
Cholestasis, Extrahepatic 25 0.0 0.0
Cleft Palate 271 0.0 0.0
Colorectal Neoplasms 243 0.0 0.0
Copper-Overload Cirrhosis 11 0.0 0.0
Diabetes Mellitus, Experimental 108 0.0 0.0
Diabetes Mellitus, Type 2 142 0.0 0.0
Diabetic Nephropathies 37 0.0 0.0
Diabetic Neuropathies 14 0.0 0.0
Dry Eye Syndromes 8 0.0 0.0
Duodenal ulcer 20 0.0 0.0
Endomyocardial Fibrosis 13 0.0 0.0
Fibrosis 44 0.0 0.0
Glomerulonephritis, IGA 34 0.0 0.0
Glomerulosclerosis, Focal Segmental 28 0.0 0.0
Hepatitis, Autoimmune 17 0.0 0.0
Hepatitis, Chronic 23 0.0 0.0
Hernia, Diaphragmatic 40 0.0 0.0
Hyperplasia 27 0.0 0.0
Hypersensitivity 63 0.0 0.0
Inflammation 120 0.0 0.0
Intervertebral Disc Degeneration 5 0.0 0.0
Kidney Diseases 114 0.0 0.0
Kidney Failure, Chronic 46 0.0 0.0
Liver Cirrhosis 181 0.0 0.0
Liver Cirrhosis, Alcoholic 16 0.0 0.0
Liver Cirrhosis, Experimental 769 0.0 0.0
Liver Neoplasms, Experimental 59 0.0 0.0
Lung Neoplasms 232 0.0 0.0
Lung diseases 50 0.0 0.0
Muscular Diseases 27 0.0 0.0
Muscular Dystrophy, Duchenne 7 0.0 0.0
Myocardial Infarction 151 0.0 0.0
Neoplasm Invasiveness 161 0.0 0.0
Neoplasm Metastasis 168 0.0 0.0
Nephrotic Syndrome 78 0.0 0.0
Non-alcoholic Fatty Liver Disease 42 0.0 0.0
Occupational Diseases 12 0.0 0.0
Oral Submucous Fibrosis 20 0.0 0.0
Osteoporosis, Postmenopausal 6 0.0 0.0
Pancreatic Neoplasms 85 0.0 0.0
Papilloma 44 0.0 0.0
Penile Induration 1 0.0 0.0
Peritoneal Fibrosis 1 0.0 0.0
Pleural Diseases 10 0.0 0.0
Pneumonia 174 0.0 0.0
Prostatic Neoplasms 495 0.0 0.0
Proteinuria 144 0.0 0.0
Pulmonary Disease, Chronic Obstructive 31 0.0 0.0
Pulmonary Fibrosis 106 0.0 0.0
Pulmonary emphysema 48 0.0 0.0
Sepsis 24 0.0 0.0
Skin Neoplasms 69 0.0 0.0
Stroke 33 0.0 0.0
Thrombocythemia, Essential 12 0.0 0.0
Uremia 19 0.0 0.0
Urticaria 67 0.0 0.0
Ventricular Remodeling 5 0.0 0.0
cystic fibrosis 1696 0.0 0.0
sarcoidosis 370 0.0 0.0
Disease Target Count
Abnormality of the humerus 6
Abnormality of the tibia 9
Abnormality of the ulna 10
Acquired scoliosis 281
Biliary cirrhosis 45
Bipolar Disorder 666
Bone marrow hypocellularity 20
Bone pain 42
Cachexia 50
Cerebrovascular accident 63
Chronic Obstructive Airway Disease 37
Class III malocclusion 78
Compression of optic nerve 7
Congenital deafness 185
Cortical thickening of long bone diaphyses 1
Cranial sclerosis 2
Craniofacial osteosclerosis 2
Curvature of spine 282
Deafness 198
Decrease in appetite 8
Decreased antibody level in blood 35
Decreased joint mobility 53
Decreased subcutaneous adipose tissue 13
Delayed Puberty 97
Dental caries 164
Depressive Symptoms 28
Depressive disorder 409
Diabetes Mellitus, Non-Insulin-Dependent 145
Diabetic Nephropathy 34
Diaphragmatic Hernia 40
Diplopia 8
Easy fatigability 18
Elevated aldolase level 2
Exocrine pancreatic insufficiency 32
Exophthalmos 112
Focal glomerulosclerosis 37
H/O: depression 2
Headache 37
Hearing Loss, Partial 185
HyperCalcification of skull base 5
HyperMineralization of skull base 5
Hyperostosis 18
Hypertensive disease 292
Hypertrophy of lower jaw 78
Hypogammaglobulinemia 35
IGA Glomerulonephritis 50
Immunologic Deficiency Syndromes 113
Increased size of mandible 78
Knee joint valgus deformity 56
Liver carcinoma 240
Malabsorption 82
Mandibular hyperplasia 78
Mood Disorders 184
Muscle Weakness 170
Myopathy 185
Neoplastic Cell Transformation 89
Neurogenic Muscular Atrophy 139
Neurogenic muscle atrophy, especially in the lower limbs 139
Nonorganic psychosis 84
Pain in limb 2
Pancreatic Insufficiency 13
Pancreatic Neoplasm 85
Peyronie Disease 1
Primary biliary cirrhosis 51
Prominent eyes 96
Prominent globes 96
Protruding eyes 96
Psychotic Disorders 151
Pyle metaphyseal dysplasia 8
Radial aplasia/hypoplasia 29
Recurrent respiratory infections 141
Rotting teeth 73
Schizophrenia 1160
Sclerosis of skull base 5
Skeletal muscle atrophy 139
Slender build 14
Spontaneous abortion 113
Squamous cell carcinoma 129
Tires quickly 18
Waddling gait 34
hearing impairment 199
mandibular excess (physical finding) 78
muscle degeneration 139

Expression

  Differential Expression (15)

Disease log2 FC p
diabetes mellitus -1.700 5.7e-03
adult high grade glioma 1.500 4.3e-03
astrocytic glioma 1.700 3.7e-03
Astrocytoma, Pilocytic 2.000 4.3e-07
atypical teratoid / rhabdoid tumor 1.200 2.0e-03
ependymoma 1.400 2.6e-02
gastric carcinoma 1.600 6.1e-03
glioblastoma 1.300 7.0e-04
lung carcinoma -1.700 6.7e-19
malignant mesothelioma 1.100 6.0e-05
medulloblastoma 1.300 1.6e-02
osteosarcoma 1.090 4.1e-04
pancreatic cancer 1.500 3.3e-03
primary pancreatic ductal adenocarcinoma 1.560 3.9e-03
ulcerative colitis 1.800 1.4e-03

Protein-protein Interaction (6)

Gene RIF (3856)

AA Sequence

MPPSGLRLLLLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPP      1 - 70
GPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQSTHSIYMFFNTSEL     71 - 140
REAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSFDVTGVVRQWLSR    141 - 210
GGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRAL    211 - 280
DTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGA    281 - 350
SAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS                                  351 - 390
//

Text Mined References (3751)

PMID Year Title