Property Summary

NCBI Gene PubMed Count 199
Grant Count 254
R01 Count 195
Funding $15,276,638.13
PubMed Score 123.31
PubTator Score 1055.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
psoriasis 1.400 0.000
nephrosclerosis -1.154 0.019
pancreatic cancer 1.300 0.000
astrocytic glioma -1.700 0.022
ependymoma -1.900 0.028
osteosarcoma 2.224 0.000
group 3 medulloblastoma -2.200 0.001
tuberculosis and treatment for 3 months -2.000 0.000
non-small cell lung cancer 1.540 0.000
intraductal papillary-mucinous adenoma (... 1.200 0.008
intraductal papillary-mucinous neoplasm ... 2.000 0.010
lung cancer 1.800 0.008
interstitial cystitis -1.200 0.005
pilocytic astrocytoma 2.200 0.000
pancreatic carcinoma 1.100 0.021
subependymal giant cell astrocytoma -1.816 0.020
spina bifida -2.165 0.039
Breast cancer -1.800 0.000
ulcerative colitis -1.300 0.002
ovarian cancer 1.400 0.005
Down syndrome 1.100 0.001

Synonym

Gene

PANTHER Protein Class (2)

PDB

1GK5   1MOX   1YUF   1YUG   2TGF   3E50   3TGF   4TGF   5KN5  

Gene RIF (148)

PMID Text
27046040 findings strongly suggest that phosphorylated HSP20 inhibits TGF-alpha-induced HCC cell migration and invasion via suppression of the JNK signaling pathway
26832151 miR-505 acts as tumor suppressor in endometrial cancer by regulating TGF-alpha.
26708425 miR-205 may function as a tumor suppressor via targeting TGF-alpha in Osteosarcoma
26279457 EGFR and TGF-alpha can be used as predictive markers for activity, fibrosis, and carcinogenesis in chronic hepatitis C patients.
26064952 our data suggest that the anti-inflammatory actions of paricalcitol in tubular cells could depend on the inhibition of TGF-a/ADAM17/EGFR pathway in response to aldosterone, showing an important mechanism of VDRAs action.
25589361 Data suggest that placental expression of TGFA, EGF (epidermal GF), and HBEGF (heparin-binding EGF-like GF) is down-regulated in pre-eclampsia as compared to normal term birth; each GF blocks cell death/apoptosis of cytotrophoblast cell line.
25234930 TGF-alpha level correlated with efficacy, and EGFR overexpression might predict cetuximab efficacy.
25083591 Statistically significant differences in serum concentration of TGF-alpha was found between patients with systemic sclerosis and controls, as well as in SSc patients with esophageal dysmotility compared to SSc patients without dysmotility.
25015300 TGFA Taq I polymorphism may be associated with the risk of cleft lip and/or palate.
24969691 Findings suggest that miR-124 inhibits TGF-alpha-induced epithelial-mesenchymal transition in human prostate cancer cell line DU145 by targeting Slug.
More...

AA Sequence

MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPA      1 - 70
CVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRH     71 - 140
EKPSALLKGRTACCHSETVV                                                      141 - 160
//

Text Mined References (203)

PMID Year Title
27046040 2016 Phosphorylated Heat Shock Protein 20 (HSPB6) Regulates Transforming Growth Factor-?-Induced Migration and Invasion of Hepatocellular Carcinoma Cells.
26832151 2016 MicroRNA-505 functions as a tumor suppressor in endometrial cancer by targeting TGF-?.
26708425 2016 MiR-205 functions as a tumor suppressor via targeting TGF-? in osteosarcoma.
26279457 2015 Impact of epidermal growth factor receptor and transforming growth factor-? on hepatitis C virus-induced hepatocarcinogenesis.
26064952 2015 Paricalcitol Inhibits Aldosterone-Induced Proinflammatory Factors by Modulating Epidermal Growth Factor Receptor Pathway in Cultured Tubular Epithelial Cells.
25589361 2015 Reduced expression of the epidermal growth factor signaling system in preeclampsia.
25416956 2014 A proteome-scale map of the human interactome network.
25335168 2014 Common variants at 1p36 are associated with superior frontal gyrus volume.
25234930 2014 Predictive biomarkers for the efficacy of cetuximab combined with cisplatin and capecitabine in advanced gastric or esophagogastric junction adenocarcinoma: a prospective multicenter phase 2 trial.
25083591 Possible implications of TGF-alpha in oesophageal dysmotility in systemic sclerosis.
More...