Property Summary

NCBI Gene PubMed Count 199
PubMed Score 123.31
PubTator Score 1055.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
non-small cell lung cancer 2798 5.20780339651571E-13
osteosarcoma 7933 1.37682315429645E-9
pancreatic cancer 2300 3.16318866863007E-7
tuberculosis and treatment for 3 months 327 5.53609433334067E-6
Breast cancer 3099 8.96674521583638E-6
pilocytic astrocytoma 3086 1.02634320017872E-4
Down syndrome 548 0.00134146782363538
group 3 medulloblastoma 2254 0.00137655138769104
ulcerative colitis 2087 0.00205777268555352
ovarian cancer 8492 0.00468366077814448
interstitial cystitis 2299 0.00485814433182954
lung cancer 4473 0.00786190381292481
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00845901997296303
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0100804320216341
nephrosclerosis 329 0.018506197153049
subependymal giant cell astrocytoma 2287 0.0199501816919638
pancreatic carcinoma 567 0.0205275661293477
astrocytic glioma 2241 0.0222890911923712
ependymoma 2514 0.0280485721025835
spina bifida 1064 0.038674098942829
Disease Target Count Z-score Confidence
Cleft Lip 91 5.212 2.6
Cleft palate 125 5.029 2.5
Cancer 2346 3.137 1.6
Disease Target Count
Tooth agenesis 38

Expression

  Differential Expression (21)

Disease log2 FC p
psoriasis 1.400 0.000
nephrosclerosis -1.154 0.019
pancreatic cancer 1.300 0.000
astrocytic glioma -1.700 0.022
ependymoma -1.900 0.028
osteosarcoma 2.224 0.000
group 3 medulloblastoma -2.200 0.001
tuberculosis and treatment for 3 months -2.000 0.000
non-small cell lung cancer 1.540 0.000
intraductal papillary-mucinous adenoma (... 1.200 0.008
intraductal papillary-mucinous neoplasm ... 2.000 0.010
lung cancer 1.800 0.008
interstitial cystitis -1.200 0.005
pilocytic astrocytoma 2.200 0.000
pancreatic carcinoma 1.100 0.021
subependymal giant cell astrocytoma -1.816 0.020
spina bifida -2.165 0.039
Breast cancer -1.800 0.000
ulcerative colitis -1.300 0.002
ovarian cancer 1.400 0.005
Down syndrome 1.100 0.001

Synonym

Gene

PANTHER Protein Class (2)

PDB

1GK5   1MOX   1YUF   1YUG   2TGF   3E50   3TGF   4TGF   5KN5  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Xenopus OMA EggNOG Inparanoid
Zebrafish EggNOG Inparanoid

Gene RIF (148)

PMID Text
27046040 findings strongly suggest that phosphorylated HSP20 inhibits TGF-alpha-induced HCC cell migration and invasion via suppression of the JNK signaling pathway
26832151 miR-505 acts as tumor suppressor in endometrial cancer by regulating TGF-alpha.
26708425 miR-205 may function as a tumor suppressor via targeting TGF-alpha in Osteosarcoma
26279457 EGFR and TGF-alpha can be used as predictive markers for activity, fibrosis, and carcinogenesis in chronic hepatitis C patients.
26064952 our data suggest that the anti-inflammatory actions of paricalcitol in tubular cells could depend on the inhibition of TGF-a/ADAM17/EGFR pathway in response to aldosterone, showing an important mechanism of VDRAs action.
25589361 Data suggest that placental expression of TGFA, EGF (epidermal GF), and HBEGF (heparin-binding EGF-like GF) is down-regulated in pre-eclampsia as compared to normal term birth; each GF blocks cell death/apoptosis of cytotrophoblast cell line.
25234930 TGF-alpha level correlated with efficacy, and EGFR overexpression might predict cetuximab efficacy.
25083591 Statistically significant differences in serum concentration of TGF-alpha was found between patients with systemic sclerosis and controls, as well as in SSc patients with esophageal dysmotility compared to SSc patients without dysmotility.
25015300 TGFA Taq I polymorphism may be associated with the risk of cleft lip and/or palate.
24969691 Findings suggest that miR-124 inhibits TGF-alpha-induced epithelial-mesenchymal transition in human prostate cancer cell line DU145 by targeting Slug.
More...

AA Sequence

MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPA      1 - 70
CVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRH     71 - 140
EKPSALLKGRTACCHSETVV                                                      141 - 160
//

Text Mined References (203)

PMID Year Title
27046040 2016 Phosphorylated Heat Shock Protein 20 (HSPB6) Regulates Transforming Growth Factor-?-Induced Migration and Invasion of Hepatocellular Carcinoma Cells.
26832151 2016 MicroRNA-505 functions as a tumor suppressor in endometrial cancer by targeting TGF-?.
26708425 2016 MiR-205 functions as a tumor suppressor via targeting TGF-? in osteosarcoma.
26279457 2015 Impact of epidermal growth factor receptor and transforming growth factor-? on hepatitis C virus-induced hepatocarcinogenesis.
26064952 2015 Paricalcitol Inhibits Aldosterone-Induced Proinflammatory Factors by Modulating Epidermal Growth Factor Receptor Pathway in Cultured Tubular Epithelial Cells.
25589361 2015 Reduced expression of the epidermal growth factor signaling system in preeclampsia.
25416956 2014 A proteome-scale map of the human interactome network.
25335168 2014 Common variants at 1p36 are associated with superior frontal gyrus volume.
25234930 2014 Predictive biomarkers for the efficacy of cetuximab combined with cisplatin and capecitabine in advanced gastric or esophagogastric junction adenocarcinoma: a prospective multicenter phase 2 trial.
25083591 Possible implications of TGF-alpha in oesophageal dysmotility in systemic sclerosis.
More...