Property Summary

NCBI Gene PubMed Count 645
PubMed Score 4903.23
PubTator Score 3606.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count
renal hypomagnesemia 4 1

Expression

  Differential Expression (13)

Disease log2 FC p
psoriasis -1.600 2.9e-04
Breast cancer -2.100 5.4e-06
gastric cancer 1.300 3.3e-03
hepatocellular carcinoma 1.100 5.3e-03
intraductal papillary-mucinous adenoma (... -4.400 2.2e-04
intraductal papillary-mucinous carcinoma... -4.200 5.2e-04
intraductal papillary-mucinous neoplasm ... -4.000 7.7e-03
lung adenocarcinoma 1.200 4.5e-07
malignant mesothelioma 2.900 3.0e-07
osteosarcoma -2.039 3.0e-05
pancreatic cancer 2.100 2.2e-04
pancreatic carcinoma 2.100 2.2e-04
primary pancreatic ductal adenocarcinoma -1.106 5.9e-03

Protein-protein Interaction (1)

Gene RIF (600)

AA Sequence

MLLTLIILLPVVSKFSFVSLSAPQHWSCPEGTLAGNGNSTCVGPAPFLIFSHGNSIFRIDTEGTNYEQLV      1 - 70
VDAGVSVIMDFHYNEKRIYWVDLERQLLQRVFLNGSRQERVCNIEKNVSGMAINWINEEVIWSNQQEGII     71 - 140
TVTDMKGNNSHILLSALKYPANVAVDPVERFIFWSSEVAGSLYRADLDGVGVKALLETSEKITAVSLDVL    141 - 210
DKRLFWIQYNREGSNSLICSCDYDGGSVHISKHPTQHNLFAMSLFGDRIFYSTWKMKTIWIANKHTGKDM    211 - 280
VRINLHSSFVPLGELKVVHPLAQPKAEDDTWEPEQKLCKLRKGNCSSTVCGQDLQSHLCMCAEGYALSRD    281 - 350
RKYCEDVNECAFWNHGCTLGCKNTPGSYYCTCPVGFVLLPDGKRCHQLVSCPRNVSECSHDCVLTSEGPL    351 - 420
CFCPEGSVLERDGKTCSGCSSPDNGGCSQLCVPLSPVSWECDCFPGYDLQLDEKSCAASGPQPFLLFANS    421 - 490
QDIRHMHFDGTDYGTLLSQQMGMVYALDHDPVENKIYFAHTALKWIERANMDGSQRERLIEEGVDVPEGL    491 - 560
AVDWIGRRFYWTDRGKSLIGRSDLNGKRSKIITKENISQPRGIAVHPMAKRLFWTDTGINPRIESSSLQG    561 - 630
LGRLVIASSDLIWPSGITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDYVWFS    631 - 700
DWAMPSVMRVNKRTGKDRVRLQGSMLKPSSLVVVHPLAKPGADPCLYQNGGCEHICKKRLGTAWCSCREG    701 - 770
FMKASDGKTCLALDGHQLLAGGEVDLKNQVTPLDILSKTRVSEDNITESQHMLVAEIMVSDQDDCAPVGC    771 - 840
SMYARCISEGEDATCQCLKGFAGDGKLCSDIDECEMGVPVCPPASSKCINTEGGYVCRCSEGYQGDGIHC    841 - 910
LDIDECQLGEHSCGENASCTNTEGGYTCMCAGRLSEPGLICPDSTPPPHLREDDHHYSVRNSDSECPLSH    911 - 980
DGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELRHAGHGQQQKVIVVAVCVVVLVMLLLLS    981 - 1050
LWGAHYYRTQKLLSKNPKNPYEESSRDVRSRRPADTEDGMSSCPQPWFVVIKEHQDLKNGGQPVAGEDGQ   1051 - 1120
AADGSMQPTSWRQEPQLCGMGTEQGCWIPVSSDKGSCPQVMERSFHMPSYGTQTLEGGVEKPHSLLSANP   1121 - 1190
LWQQRALDPPHQMELTQ                                                        1191 - 1207
//

Text Mined References (652)

PMID Year Title