Property Summary

NCBI Gene PubMed Count 604
PubMed Score 4837.66
PubTator Score 3606.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
malignant mesothelioma 3163 2.97606433232393E-7
lung adenocarcinoma 2714 4.53718557747878E-7
Breast cancer 3099 5.42611411721308E-6
osteosarcoma 7933 3.00166906607395E-5
pancreatic carcinoma 567 2.15909302894275E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 2.17618642773706E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 5.19933843928485E-4
pancreatic cancer 2300 0.00171675435435731
gastric cancer 436 0.00325344223803566
hepatocellular carcinoma 550 0.00526894838337028
primary pancreatic ductal adenocarcinoma 1271 0.00586093019870922
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00769637808233021
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count
renal hypomagnesemia 4 1
Disease Target Count
Hypomagnesemia 4 1

Expression

Synonym

Accession P01133 B4DRK7 E7EVD2 E9PBF0 Q52LZ6 EGF
Symbols URG
HOMG4

Gene

EGF

PDB

1IVO   1JL9   1NQL   1P9J   2KV4   3NJP  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

 GWAS Trait (1)

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
624355 other 0 / 0 / 0 Late stage results from the probe development efforts to identify dual inhibitors of signal transducer and activator of transcription 3 (STAT3) and nuclear factor NF-kappa-B (NF-kB): Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
624406 other 0 / 0 / 0 Late stage results from the probe development effort to identify inhibitors of Hepatitis C Virus (HCV) core protein dimerization: Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs

Gene RIF (563)

PMID Text
27068127 the role of Epidermal Growth Factor (EGF) and Poly-L-Ornithine (PLO) and PDX1 on human amnion epithelial cell differentiation process, is reported.
26861207 EGF induces transient Ras activation and feedback phosphorylation of Sos.
26841646 There was evidence for the involvement of PDGF, IGF-1, and EGF in primary pulmonary hypoplasia. PDGF deficiency plays a certain role in secondary pulmonary hypoplasia
26830684 CD24 regulates EGFR signaling by inhibiting EGFR internalization and degradation in a RhoA-dependent manner in gastric cancer cells.
26774845 This study showed that CTX III inhibitory effect on EGF-evoked invasion of MDA-MB-231 cells is mediated through suppressing EGF/EGFR activation and EMT process.
26691015 that strong FN1 promoter activity drives inappropriate expression of the biologically active portion of EGF
26686751 This can be achieved by either blocking the EGF or CSF-1 receptors or supressing the EGF or CSF-1 signal.
26625757 The present study revealed that the EGF A61G genotype may be a novel independent prognostic marker to identify patients at higher risk of occurrence and an unfavourable clinical outcome.
26620571 endometrial- and/or conceptus derived EGF effects migration of uterine luminal epithelium.
26609808 This ubiquitin-mediated switch in EGFR trafficking is a uniquely suited solution to suppress spontaneous activation while maintaining responsiveness to EGF.
More...

AA Sequence

MLLTLIILLPVVSKFSFVSLSAPQHWSCPEGTLAGNGNSTCVGPAPFLIFSHGNSIFRIDTEGTNYEQLV      1 - 70
VDAGVSVIMDFHYNEKRIYWVDLERQLLQRVFLNGSRQERVCNIEKNVSGMAINWINEEVIWSNQQEGII     71 - 140
TVTDMKGNNSHILLSALKYPANVAVDPVERFIFWSSEVAGSLYRADLDGVGVKALLETSEKITAVSLDVL    141 - 210
DKRLFWIQYNREGSNSLICSCDYDGGSVHISKHPTQHNLFAMSLFGDRIFYSTWKMKTIWIANKHTGKDM    211 - 280
VRINLHSSFVPLGELKVVHPLAQPKAEDDTWEPEQKLCKLRKGNCSSTVCGQDLQSHLCMCAEGYALSRD    281 - 350
RKYCEDVNECAFWNHGCTLGCKNTPGSYYCTCPVGFVLLPDGKRCHQLVSCPRNVSECSHDCVLTSEGPL    351 - 420
CFCPEGSVLERDGKTCSGCSSPDNGGCSQLCVPLSPVSWECDCFPGYDLQLDEKSCAASGPQPFLLFANS    421 - 490
QDIRHMHFDGTDYGTLLSQQMGMVYALDHDPVENKIYFAHTALKWIERANMDGSQRERLIEEGVDVPEGL    491 - 560
AVDWIGRRFYWTDRGKSLIGRSDLNGKRSKIITKENISQPRGIAVHPMAKRLFWTDTGINPRIESSSLQG    561 - 630
LGRLVIASSDLIWPSGITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDYVWFS    631 - 700
DWAMPSVMRVNKRTGKDRVRLQGSMLKPSSLVVVHPLAKPGADPCLYQNGGCEHICKKRLGTAWCSCREG    701 - 770
FMKASDGKTCLALDGHQLLAGGEVDLKNQVTPLDILSKTRVSEDNITESQHMLVAEIMVSDQDDCAPVGC    771 - 840
SMYARCISEGEDATCQCLKGFAGDGKLCSDIDECEMGVPVCPPASSKCINTEGGYVCRCSEGYQGDGIHC    841 - 910
LDIDECQLGEHSCGENASCTNTEGGYTCMCAGRLSEPGLICPDSTPPPHLREDDHHYSVRNSDSECPLSH    911 - 980
DGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELRHAGHGQQQKVIVVAVCVVVLVMLLLLS    981 - 1050
LWGAHYYRTQKLLSKNPKNPYEESSRDVRSRRPADTEDGMSSCPQPWFVVIKEHQDLKNGGQPVAGEDGQ   1051 - 1120
AADGSMQPTSWRQEPQLCGMGTEQGCWIPVSSDKGSCPQVMERSFHMPSYGTQTLEGGVEKPHSLLSANP   1121 - 1190
LWQQRALDPPHQMELTQ                                                        1191 - 1207
//

Text Mined References (611)

PMID Year Title
27068127 2016 The combined effect of PDX1, epidermal growth factor and poly-L-ornithine on human amnion epithelial cells' differentiation.
26861207 2016 Feedback activation of neurofibromin terminates growth factor-induced Ras activation.
26841646 [Immunohistochemical changes in the lungs from fetuses and newborn infants at 20- 40 weeks' gestation with false left-sided congenital diaphragmatic hernia].
26830684 2016 CD24 associates with EGFR and supports EGF/EGFR signaling via RhoA in gastric cancer cells.
26774845 2016 Taiwan cobra cardiotoxin III suppresses EGF/EGFR-mediated epithelial-to-mesenchymal transition and invasion of human breast cancer MDA-MB-231 cells.
26691015 2016 FN1-EGF gene fusions are recurrent in calcifying aponeurotic fibroma.
26686751 2016 3-D individual cell based computational modeling of tumor cell-macrophage paracrine signaling mediated by EGF and CSF-1 gradients.
26625757 2015 Clinical Implication of EGF A61G Polymorphism in the Risk of Non Small Cell Lung Adenocarcinoma Patients: A Case Control Study.
26620571 2016 Epidermal growth factor: Porcine uterine luminal epithelial cell migratory signal during the peri-implantation period of pregnancy.
26609808 2015 EGF-dependent re-routing of vesicular recycling switches spontaneous phosphorylation suppression to EGFR signaling.
More...