Property Summary

Ligand Count 1
NCBI Gene PubMed Count 297
PubMed Score 1795.48
PubTator Score 759.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
malignant mesothelioma 3232 1.9e-08
lung cancer 4740 9.6e-03
Disease Target Count Z-score Confidence
Cancer 2499 5.067 2.5

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer -1.100 9.6e-03
malignant mesothelioma 2.900 1.9e-08

Gene RIF (218)

AA Sequence

MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSG      1 - 70
GELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQ     71 - 140
CRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQRAKTPQTRVTI    141 - 210
RTVRVRRPPKGKHRKFKHTHDKTALKETLGA                                           211 - 241
//

Text Mined References (296)

PMID Year Title