Property Summary

NCBI Gene PubMed Count 274
Grant Count 863
R01 Count 338
Funding $314,865,990.8
PubMed Score 1684.00
PubTator Score 759.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 2.900 0.000
lung cancer -1.100 0.010

Synonym

Accession P01127 G3XAG8 P78431 Q15354 Q6FHE7 Q9UF23 PDGF subunit B
Symbols SIS
SSV
IBGC5
PDGF2
c-sis
PDGF-2

Gene

PANTHER Protein Class (2)

PDB

1PDG   3MJG   4HQU   4HQX   4QCI  

Gene RIF (216)

PMID Text
26932148 Case Report: congenital atrophic dermatofibrosarcoma protuberans with COL1A1-PDGFB rearrangement.
26599395 loss-of-function mutations in PDGFB or PDGFRB cause Primary Familial Brain Calcification.
26518873 Regulation of Hyaluronan (HA) Metabolism Mediated by HYBID (Hyaluronan-binding Protein Involved in HA Depolymerization, KIAA1199) and HA Synthases in Growth Factor-stimulated Fibroblasts.
26463591 Electron microscopy structure of PDGFRB [a full-length human platelet-derived growth factor receptor], in complex with its ligand PDGF-B.
26420039 Human uPAR activation and its association with beta1-integrin are required for PDGF-AB-induced migration.
26418719 Loss of Nf2 and Cdkn2a/b have synergistic effects with PDGF-B overexpression promoting meningioma malignant transformation.
26371596 Suggest that PDGF-B signaling may play a role in endothelial and cardiomyocyte recovery from ischemia reperfusion injury after heart transplantation.
26353894 Placental endothelial cell-derived PDGF-BB recruits human placental multipotent mesenchymal stromal cells involved in vascular development via PDGFR-beta/STAT3 activation
26320430 Three factor model revealed significant gene-gene interaction for PDGFB +286A>G, PDGFB +1135A>C and HER2 Ile165Val SNPs with GBC. Protein-protein interaction showed significant association of PDGFB and HER2 with EGFR receptor signaling pathway.
26129893 Lessons from SLC20A2, PDGFB, and PDGFRB mutation carriers. Three causative genes have been identified: SLC20A2, PDGFRB and, recently, PDGFB, whose associated phenotype has not yet been extensively studied.
More...

AA Sequence

MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSG      1 - 70
GELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQ     71 - 140
CRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQRAKTPQTRVTI    141 - 210
RTVRVRRPPKGKHRKFKHTHDKTALKETLGA                                           211 - 241
//

Text Mined References (274)

PMID Year Title
26932148 2016 Congenital atrophic dermatofibrosarcoma protuberans detected by COL1A1-PDGFB rearrangement.
26599395 2015 Functional Characterization of Germline Mutations in PDGFB and PDGFRB in Primary Familial Brain Calcification.
26518873 2015 Regulation of Hyaluronan (HA) Metabolism Mediated by HYBID (Hyaluronan-binding Protein Involved in HA Depolymerization, KIAA1199) and HA Synthases in Growth Factor-stimulated Fibroblasts.
26493107 2015 miRNA-34a reduces neointima formation through inhibiting smooth muscle cell proliferation and migration.
26463591 2015 Structure of Full-Length Human PDGFR? Bound to Its Activating Ligand PDGF-B as Determined by Negative-Stain Electron Microscopy.
26420039 2015 Urokinase-type plasminogen activator receptor interaction with ?1 integrin is required for platelet-derived growth factor-AB-induced human mesenchymal stem/stromal cell migration.
26418719 2015 PDGF activation in PGDS-positive arachnoid cells induces meningioma formation in mice promoting tumor progression in combination with Nf2 and Cdkn2ab loss.
26371596 2016 Platelet-derived Growth Factor-B Protects Rat Cardiac Allografts From Ischemia-reperfusion Injury.
26353894 2015 Human placenta-derived multipotent mesenchymal stromal cells involved in placental angiogenesis via the PDGF-BB and STAT3 pathways.
26320430 2015 Platelet Derived Growth Factor-B and Human Epidermal Growth Factor Receptor-2 Polymorphisms in Gall Bladder Cancer.
More...