Property Summary

NCBI Gene PubMed Count 1,699
PubMed Score 5694.20
PubTator Score 6807.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (8)

Disease Target Count P-value
osteosarcoma 7933 5.21159056999305E-14
juvenile dermatomyositis 1189 1.88963552227722E-10
acute quadriplegic myopathy 1157 3.46718717405273E-8
medulloblastoma, large-cell 6234 2.13060526114683E-6
psoriasis 6685 4.46830451260313E-6
Amyotrophic Lateral Sclerosis 432 5.70405744497011E-6
atypical teratoid / rhabdoid tumor 4369 1.44366801171827E-5
Pick disease 1893 5.60968236461536E-5
dermatomyositis 967 3.97312225211221E-4
medulloblastoma 1524 7.44486410169088E-4
Rheumatoid Arthritis 1171 0.00144702445830335
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00211502822156327
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0032295754528693
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00339089982174504
glioblastoma 5572 0.0036094596206706
ulcerative colitis 2087 0.00784909321558887
Parkinson's disease 364 0.00790653942489597
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0123290467910982
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.013034107776016
subependymal giant cell astrocytoma 2287 0.0153721363686962
astrocytic glioma 2241 0.023349733938814
oligodendroglioma 2849 0.0238557997583401
Multiple myeloma 1328 0.0269938198185022
lung adenocarcinoma 2714 0.0310728285952486
ependymoma 2514 0.0413706817061704
chronic lymphocytic leukemia 244 0.0495383821974263
Disease Target Count Z-score Confidence
Autoimmune Lymphoproliferative Syndrome 12 0.0 5.0
Disease Target Count Z-score Confidence
Cancer 2346 7.528 3.8
Cardiomyopathy 110 0.0 4.0
Intellectual disability 573 0.0 4.0

Expression

Synonym

Accession P01116 A8K8Z5 B0LPF9 P01118 Q96D10
Symbols NS
NS3
CFC2
RALD
KRAS1
KRAS2
RASK2
KI-RAS
C-K-RAS
K-RAS2A
K-RAS2B
K-RAS4A
K-RAS4B
c-Ki-ras2

Gene

PDB

1D8D   1D8E   1KZO   1KZP   3GFT   4DSN   4DSO   4EPR   4EPT   4EPV   4EPW   4EPX   4EPY   4L8G   4LDJ   4LPK   4LRW   4LUC   4LV6   4LYF   4LYH   4LYJ   4M1O   4M1S   4M1T   4M1W   4M1Y   4M21   4M22   4NMM   4OBE   4PZY   4PZZ   4Q01   4Q02   4Q03   4QL3   4TQ9   4TQA   4WA7   5F2E  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (1737)

PMID Text
27179269 conclude that from the point of view of practical KRAS mutation testing for predictive purposes in patients with colorectal cancer
27082577 The KRAS mutated Colorectal Cancers have less aggressive phenotype in comparison to the BRAF-mutated Colorectal Cancers.
27064574 KRAS Mutation is associated with response to therapy in Rectal Cancer.
27008036 KRAS mutations are more common in females and smokers, but are not associated with chronic obstructive pulmonary disease status in non-small cell lung cancer patients.
26997442 Low incidence of KRAS mutations in adenocarcinomas of the ampulla of Vater suggest no major role in tumorigenesis.
26977885 The therapeutic potential of PKCiota-ELF3-NOTCH3 signal inhibition to more effectively treat KRAS LADC.
26977001 Results show that the presence of KRAS mutation (especially KRAS G12C mutation) correlated with adverse prognosis in non-small cell lung cancer patients treated with second- or third-line pemetrexed or docetaxel.
26933204 the RAS mutation in lymphoid cells is tightly linked with various autoimmune symptoms. The presence of the RAS mutation in lymphocytes should be reconsidered as a pathogenesis in cases of autoimmunity.
26921316 This study identifies the molecular basis for the S-phase arrest caused by Q deprivation in KRas-driven cancer cells that arrest in S-phase in response to Q deprivation.
26891420 The combination of tivantinib and CETIRI was well tolerated but did not significantly improve PFS in previously treated KRAS WT metastatic colorectal cancer
More...

AA Sequence

MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQ      1 - 70
YMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIP     71 - 140
FIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM                         141 - 189
//

Text Mined References (1704)

PMID Year Title
27179269 2016 Concordance of KRAS mutation status between luminal and peripheral regions of primary colorectal cancer. A laser-capture microdissection-based study.
27082577 2016 MicroRNA Expression Signatures Associated With BRAF-Mutated Versus KRAS-Mutated Colorectal Cancers.
27064574 2016 Heterogeneity of KRAS Mutation Status in Rectal Cancer.
27008036 2016 Chronic Obstructive Pulmonary Disease Is Not Associated with KRAS Mutations in Non-Small Cell Lung Cancer.
26997442 2016 Low incidence of KRAS, BRAF, and PIK3CA mutations in adenocarcinomas of the ampulla of Vater and their prognostic value.
26977885 2016 Protein Kinase C? Drives a NOTCH3-dependent Stem-like Phenotype in Mutant KRAS Lung Adenocarcinoma.
26977001 2016 The Prognostic Role of KRAS Mutation in Patients with Advanced NSCLC Treated with Second- or Third-line Chemotherapy.
26933204 2016 Autoimmunity Including Intestinal Behçet Disease Bearing the KRAS Mutation in Lymphocytes: A Case Report.
26921316 2016 Aspartate Rescues S-phase Arrest Caused by Suppression of Glutamine Utilization in KRas-driven Cancer Cells.
26891420 2016 A randomized, placebo-controlled, phase 1/2 study of tivantinib (ARQ 197) in combination with irinotecan and cetuximab in patients with metastatic colorectal cancer with wild-type KRAS who have received first-line systemic therapy.
More...