Property Summary

NCBI Gene PubMed Count 606
PubMed Score 9497.88
PubTator Score 1733.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (8)

Disease Target Count P-value
ovarian cancer 8492 7.82992939813022E-6
lung cancer 4473 8.12081495445866E-4
astrocytic glioma 2241 0.00798799357033183
Disease Target Count Z-score Confidence
Cancer 2346 7.763 3.9

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytic glioma -1.100 0.008
lung cancer 1.100 0.001
ovarian cancer 1.600 0.000

Synonym

Accession P01112 B5BUA0 Q14080 Q6FHV9 Q9BR65 Q9UCE2
Symbols CTLO
HAMSV
HRAS1
RASH1
p21ras
C-H-RAS
H-RASIDX
C-BAS/HAS
C-HA-RAS1

Gene

PDB

121P   1AA9   1AGP   1BKD   1CLU   1CRP   1CRQ   1CRR   1CTQ   1GNP   1GNQ   1GNR   1HE8   1IAQ   1IOZ   1JAH   1JAI   1K8R   1LF0   1LF5   1LFD   1NVU   1NVV   1NVW   1NVX   1P2S   1P2T   1P2U   1P2V   1PLJ   1PLK   1PLL   1Q21   1QRA   1RVD   1WQ1   1XCM   1XD2   1XJ0   1ZVQ   1ZW6   221P   2C5L   2CE2   2CL0   2CL6   2CL7   2CLC   2CLD   2EVW   2GDP   2LCF   2LWI   2N42   2N46   2Q21   2QUZ   2RGA   2RGB   2RGC   2RGD   2RGE   2RGG   2UZI   2VH5   2X1V   3DDC   3I3S   3K8Y   3K9L   3K9N   3KKM   3KKN   3KUD   3L8Y   3L8Z   3LBH   3LBI   3LBN   3LO5   3OIU   3OIV   3OIW   3RRY   3RRZ   3RS0   3RS2   3RS3   3RS4   3RS5   3RS7   3RSL   3RSO   3TGP   421P   4DLR   4DLS   4DLT   4DLU   4DLV   4DLW   4DLX   4DLY   4DLZ   4DST   4DSU   4EFL   4EFM   4EFN   4G0N   4G3X   4K81   4L9S   4L9W   4NYI   4NYJ   4NYM   4Q21   4RSG   4URU   4URV   4URW   4URX   4URY   4URZ   4US0   4US1   4US2   4XVQ   4XVR   521P   5B2Z   5B30   5P21   621P   6Q21   721P   821P  

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (441)

PMID Text
27067779 our data suggest roles for HRAS and EGFR as drivers in a subset of poroma and porocarcinoma.
26858456 Endocytosis separates EGF receptors from endogenous fluorescently labeled HRas and diminishes receptor signaling to MAP kinases in endosomes.
26674223 Data show that heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) unfolds the HRAS protein i-motif.
26636543 mTOR kinase inhibitor pp242 causes mitophagy terminated by apoptotic cell death in E1A-Ras transformed cells.
26620726 We describe extensively the tumor suppressive and oncogenic roles of miRNAs in regulation of ras oncogenes in Oral squamous cell carcinoma
26617336 SHP2 activity is elevated in astrocytes isolated from glioblastoma multiforme-prone H-Ras(12V) knock-in mice.
26568031 Phenotypic Screening Identifies Protein Synthesis Inhibitors as H-Ras-Nanocluster-Increasing Tumor Growth Inducers.
26565026 Ras.GDP weakly binds to the catalytic but not to the allosteric site of Sos.
26560143 analysis of HRAS, KRAS and NRAS expression in colorectal tumor cells
26544513 Data show that Ba/F3 cells transformed with mutant HRAS protien indicated equal sensitivity towards Map kinase kinase (MEK) and mTOR serine-threonine kinase (mTOR) inhibition.
More...

AA Sequence

MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQ      1 - 70
YMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIP     71 - 140
YIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS                         141 - 189
//

Text Mined References (615)

PMID Year Title
27067779 2016 Porocarcinomas harbor recurrent HRAS-activating mutations and tumor suppressor inactivating mutations.
26858456 2016 Endocytosis separates EGF receptors from endogenous fluorescently labeled HRas and diminishes receptor signaling to MAP kinases in endosomes.
26674223 2015 GC-elements controlling HRAS transcription form i-motif structures unfolded by heterogeneous ribonucleoprotein particle A1.
26636543 2015 mTOR kinase inhibitor pp242 causes mitophagy terminated by apoptotic cell death in E1A-Ras transformed cells.
26620726 2016 MicroRNAs: Modulators of the Ras Oncogenes in Oral Cancer.
26617336 2015 Inhibition of SHP2-mediated dephosphorylation of Ras suppresses oncogenesis.
26568031 2015 Phenotypic Screening Identifies Protein Synthesis Inhibitors as H-Ras-Nanocluster-Increasing Tumor Growth Inducers.
26565026 2016 Monitoring Ras Interactions with the Nucleotide Exchange Factor Son of Sevenless (Sos) Using Site-specific NMR Reporter Signals and Intrinsic Fluorescence.
26560143 2015 Absolute Quantification of Endogenous Ras Isoform Abundance.
26544513 2015 Mutant HRAS as novel target for MEK and mTOR inhibitors.
More...