Property Summary

NCBI Gene PubMed Count 363
Grant Count 471
R01 Count 242
Funding $46,281,117.87
PubMed Score 880.39
PubTator Score 1131.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma 2.411 0.001
glioblastoma 1.500 0.001
atypical teratoid/rhabdoid tumor 1.600 0.000
juvenile dermatomyositis 1.284 0.000
primary pancreatic ductal adenocarcinoma 1.058 0.008
Breast cancer 4.500 0.022
pediatric high grade glioma 1.500 0.000
group 3 medulloblastoma 1.200 0.000
ovarian cancer 2.100 0.000

Synonym

Accession P01111 Q14971 Q15104 Q15282
Symbols NS6
CMNS
NCMS
ALPS4
N-ras
NRAS1

Gene

PDB

2N9C   3CON  

Gene RIF (322)

PMID Text
26807515 MC1R status is associated with BRAF(V600E), BRAF(V600K), and NRAS mutations in cutaneous melanomas
26701913 ABHD17 catalytic activity is required for N-Ras depalmitoylation and re-localization to internal cellular membranes.
26597176 The patient's resected brain tumor is BRAF V600E mutated, NRAS wild type (WT), and TERT C250T mutated. The patient is a carrier of germline variants in immunomodulatory loci associated with prolonged survival.
26581482 Data show that 11/105 patients failed all molecular analysis: no mutations in oncogenes EGFR, KRAS and NRAS were detected, and no ALK gene rearrangements or MET gene amplifications were identified.
26562302 Data show that tet methylcytosine dioxygenase 2 TET2, isocitrate dehydrogenases 1/2 IDH1/IDH2, serine/arginine-rich splicing factor 2 SRSF2, splicing factor 3b subunit 1 SF3B1, and ras proteins (KRAS/NRAS) are not conserved in dog mast Cell tumors.
26562020 Data indicate that mutations in PTEN phosphatase A167T and NRAS protein Q61L, and proto-oncogene protein BRAF V600E were detected in melanoma cell line.
26560143 analysis of HRAS, KRAS and NRAS expression in colorectal tumor cells
26547258 study concluded that 26% of patients had detectable FLT3-ITD or RAS mutation at transformation from myelodysplastic syndrome to acute myeloid leukemia, and these mutations were associated with very poor outcome
26515069 The neutron crystal structure presented here puts in question our understanding of the pre-catalytic state associated with the hydrolysis reaction central to the function of RAS and other GTPases.
26471487 NRAS mutation is associated with response to therapy in Colorectal Carcinoma.
More...

AA Sequence

MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQ      1 - 70
YMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIP     71 - 140
FIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM                         141 - 189
//

Text Mined References (367)

PMID Year Title
26807515 2016 Histologic and Phenotypic Factors and MC1R Status Associated with BRAF(V600E), BRAF(V600K), and NRAS Mutations in a Community-Based Sample of 414 Cutaneous Melanomas.
26701913 2015 ABHD17 proteins are novel protein depalmitoylases that regulate N-Ras palmitate turnover and subcellular localization.
26597176 2015 Somatic and germline analyses of a long term melanoma survivor with a recurrent brain metastasis.
26581482 2015 Focused molecular analysis of small cell lung cancer: feasibility in routine clinical practice.
26562302 2015 Mutational Hotspot of TET2, IDH1, IDH2, SRSF2, SF3B1, KRAS, and NRAS from Human Systemic Mastocytosis Are Not Conserved in Canine Mast Cell Tumors.
26562020 2015 SNPase-ARMS qPCR: Ultrasensitive Mutation-Based Detection of Cell-Free Tumor DNA in Melanoma Patients.
26560143 2015 Absolute Quantification of Endogenous Ras Isoform Abundance.
26547258 2015 Detectable FLT3-ITD or RAS mutation at the time of transformation from MDS to AML predicts for very poor outcomes.
26515069 2015 Neutron Crystal Structure of RAS GTPase Puts in Question the Protonation State of the GTP ?-Phosphate.
26471487 2016 Mutation Spectra of Common Cancer-Associated Genes in Different Phenotypes of Colorectal Carcinoma Without Distant Metastasis.
More...