Property Summary

NCBI Gene PubMed Count 1,589
PubMed Score 12358.01
PubTator Score 6749.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Immune system cancer 140 0.0 1.0
Lymphoid leukemia 160 0.0 1.0
Disease Target Count Z-score Confidence
Multiple Sclerosis 540 0.0 3.0
Urinary bladder cancer 36 0.0 3.0
Disease Target Count Z-score Confidence
Cancer 2499 7.726 3.9

Expression

  Differential Expression (27)

See source...

 OMIM Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (1471)

AA Sequence

MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLC      1 - 70
SPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSA     71 - 140
AAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCAS    141 - 210
QDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESG    211 - 280
SPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDT    281 - 350
EENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLL    351 - 420
RKRREQLKHKLEQLRNSCA                                                       421 - 439
//

Text Mined References (1606)

PMID Year Title