Property Summary

NCBI Gene PubMed Count 1,388
PubMed Score 11730.82
PubTator Score 6749.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 8.31468961233769E-12
lung carcinoma 2844 1.11019677324484E-10
acute quadriplegic myopathy 1157 3.13204893417541E-7
group 3 medulloblastoma 2254 7.29749372541606E-7
medulloblastoma, large-cell 6234 1.32660778535731E-5
adrenocortical carcinoma 1427 4.50384722043357E-5
chronic lymphocytic leukemia 244 6.73867846067966E-5
psoriasis 6685 8.49433591873046E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 4.7606517499352E-4
pilocytic astrocytoma 3086 6.88723946418617E-4
invasive ductal carcinoma 2950 9.95290792463493E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00114306934489069
non diabetic and post-ischemic heart failure 200 0.0016664778325629
inflammatory breast cancer 404 0.00187060925733321
pediatric high grade glioma 2712 0.00190873208193219
oligodendroglioma 2849 0.00914600999124903
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00934414852239867
nasopharyngeal carcinoma 1056 0.00935742480645125
Multiple myeloma 1328 0.0125173001058565
Common variable immunodeficiency 98 0.0163370071151647
primitive neuroectodermal tumor 3031 0.0284201515838052
astrocytoma 1493 0.0410456771189407
chronic rhinosinusitis 512 0.0413556197087222
atypical teratoid / rhabdoid tumor 4369 0.0460804167836481
Disease Target Count Z-score Confidence
Multiple Sclerosis 498 0.0 2.0
Urinary bladder cancer 34 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 7.659 3.8

Expression

See source...

Synonym

Accession P01106 A8WFE7 P01107 Q14026
Symbols MRTL
MYCC
c-Myc
bHLHe39

Gene

MYC

PDB

1A93   1EE4   1MV0   1NKP   2A93   2OR9   4Y7R  

  Ortholog (10)

Gene RIF (1278)

PMID Text
27009366 This work reveals a previously unrecognized function for ELL as an E3 ubiquitin ligase for c-Myc and a potential tumour suppressor.
27002159 This work demonstrates that alpha2M*/CS-GRP78 acts as an upstream regulator of the PDK1/PLK1 signaling axis to modulate c-MYC transcription and its target genes, suggesting a therapeutic strategy for targeting c-MYC-associated malignant progression.
26966191 MYC appears to initiate and maintain tumorigenesis, in part, through the modulation of immune regulatory molecules.
26950360 These findings demonstrate that MYC-overexpressing TNBC shows an increased bioenergetic reliance on fatty acid oxidation(FAO) and identify the inhibition of FAO as a potential therapeutic strategy for this subset of breast cancer.
26926447 Immunohistochemical panel of CDX2, p120ctn, c-Myc, and Jagged1 proteins would be to distinguish between low/high grade dysplasia in histologically challenging cases of Barrett's esophagus.
26908019 MiR-494 has an anti-tumor role in Epithelial ovarian cancer via c-Myc.
26853883 our data highlight an important role for KLF2/c-myc pathway in HCC development and progression.
26850841 when overexpressed, c-MYC is able to repress Per1 transactivation by BMAL1/CLOCK via targeting selective E-box sequences. Importantly, upon serum stimulation, MYC was detected in BMAL1 protein complexes
26825774 LMWHA/RHAMM downstream signaling regulates fibrosarcoma cell growth in a beta-catenin/c-myc dependent manner.
26820684 Suggest that first line therapy for diffuse large B-cell lymphomas should be more specifically targeted against MYC and the genes and proteins that are deregulated by MYC.
More...

AA Sequence

MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLC      1 - 70
SPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSA     71 - 140
AAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCAS    141 - 210
QDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESG    211 - 280
SPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDT    281 - 350
EENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLL    351 - 420
RKRREQLKHKLEQLRNSCA                                                       421 - 439
//

Text Mined References (1403)

PMID Year Title
27009366 2016 ELL targets c-Myc for proteasomal degradation and suppresses tumour growth.
27002159 2016 Activated ?2-Macroglobulin Regulates Transcriptional Activation of c-MYC Target Genes through Cell Surface GRP78 Protein.
26966191 2016 MYC regulates the antitumor immune response through CD47 and PD-L1.
26950360 2016 Inhibition of fatty acid oxidation as a therapy for MYC-overexpressing triple-negative breast cancer.
26926447 2016 Increasing diagnostic accuracy to grade dysplasia in Barrett's esophagus using an immunohistochemical panel for CDX2, p120ctn, c-Myc and Jagged1.
26908019 2016 MiR-494 Inhibits Epithelial Ovarian Cancer Growth by Targeting c-Myc.
26853883 2016 Krüppel-like factor 2 promotes cell proliferation in hepatocellular carcinoma through up-regulation of c-myc.
26850841 2016 c-MYC targets the central oscillator gene Per1 and is regulated by the circadian clock at the post-transcriptional level.
26825774 2016 Receptor for hyaluronic acid- mediated motility (RHAMM) regulates HT1080 fibrosarcoma cell proliferation via a ?-catenin/c-myc signaling axis.
26820684 2016 Diffuse large B-cell lymphoma with MYC gene rearrangements: Current perspective on treatment of diffuse large B-cell lymphoma with MYC gene rearrangements; case series and review of the literature.
More...