Property Summary

NCBI Gene PubMed Count 329
PubMed Score 13598.83
PubTator Score 3823.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Cancer 2499 5.846 2.9

Expression

  Differential Expression (33)

Disease log2 FC p
hepatocellular carcinoma -1.200 5.8e-03
acute myeloid leukemia 1.200 4.3e-02
adrenocortical carcinoma -2.000 6.4e-03
aldosterone-producing adenoma -2.293 1.5e-02
astrocytoma 3.300 2.1e-03
Breast cancer -2.600 1.6e-07
breast carcinoma -2.100 1.2e-04
chronic lymphosyte leukemia -3.300 6.6e-12
colon cancer -2.500 2.0e-02
Down syndrome 1.300 3.4e-02
fascioscapulohumeral muscular dystrophy 1.962 5.4e-03
fibroadenoma -2.700 1.0e-02
gastric cancer -1.700 2.2e-04
glioblastoma 3.300 1.2e-03
group 4 medulloblastoma -2.400 6.0e-03
limb girdle muscular dystrophy 2I 1.974 3.1e-02
lung adenocarcinoma -1.200 1.2e-05
lung cancer -2.800 1.7e-05
lung carcinoma -2.400 3.2e-09
malignant mesothelioma 1.200 1.8e-06
nephrosclerosis -2.599 9.3e-04
non primary Sjogren syndrome sicca -1.400 2.9e-02
non-small cell lung cancer -2.224 1.8e-13
ovarian cancer 2.300 2.1e-03
periodontitis 1.200 2.2e-12
pituitary cancer -3.800 2.2e-05
posterior fossa group A ependymoma 1.300 1.0e-02
psoriasis -1.100 2.1e-10
pterygium -3.500 2.7e-02
Rheumatoid arthritis 1.800 5.4e-04
ulcerative colitis 2.600 9.3e-04
urothelial carcinoma -2.900 2.2e-03
Waldenstrons macroglobulinemia 1.126 4.9e-02

Protein-protein Interaction (10)

Gene RIF (256)

AA Sequence

MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTS      1 - 70
PDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKR     71 - 140
RIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDL    141 - 210
GFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRP    211 - 280
SGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADS    281 - 350
FPSCAAAHRKGSSSNEPSSDSLSSPTLLAL                                            351 - 380
//

Text Mined References (336)

PMID Year Title