Property Summary

Ligand Count 59
NCBI Gene PubMed Count 156
PubMed Score 11365.40
PubTator Score 4883.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
psoriasis 6694 2.1e-07
pancreatic ductal adenocarcinoma liver metastasis 1962 2.1e-02
nephrosclerosis 333 4.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Disease of metabolism 18 0.0 3.0
Globe disease 67 0.0 3.0
Vascular disease 319 0.0 3.0

Expression

  Differential Expression (3)

Disease log2 FC p
nephrosclerosis -2.001 4.5e-02
pancreatic ductal adenocarcinoma liver m... -1.941 2.1e-02
psoriasis -2.100 2.1e-07

 CSPA Cell Line (3)

Protein-protein Interaction (10)

Gene RIF (78)

AA Sequence

MKLITILFLCSRLLLSLTQESQSEEIDCNDKDLFKAVDAALKKYNSQNQSNNQFVLYRITEATKTVGSDT      1 - 70
FYSFKYEIKEGDCPVQSGKTWQDCEYKDAAKAATGECTATVGKRSSTKFSVATQTCQITPAEGPVVTAQY     71 - 140
DCLGCVHPISTQSPDLEPILRHGIQYFNNNTQHSSLFMLNEVKRAQRQVVAGLNFRITYSIVQTNCSKEN    141 - 210
FLFLTPDCKSLWNGDTGECTDNAYIDIQLRIASFSQNCDIYPGKDFVQPPTKICVGCPRDIPTNSPELEE    211 - 280
TLTHTITKLNAENNATFYFKIDNVKKARVQVVAGKKYFIDFVARETTCSKESNEELTESCETKKLGQSLD    281 - 350
CNAEVYVVPWEKKIYPTVNCQPLGMISLMKRPPGFSPFRSSRIGEIKEETTVSPPHTSMAPAQDEERDSG    351 - 420
KEQGHTRRHDWGHEKQRKHNLGHGHKHERDQGHGHQRGHGLGHGHEQQHGLGHGHKFKLDDDLEHQGGHV    421 - 490
LDHGHKHKHGHGHGKHKNKGKKNGKHNGWKTEHLASSSEDSTTPSAQTQEKTEGPTPIPSLAKPGVTVTF    491 - 560
SDFQDSDLIATMMPPISPAPIQSDDDWIPDIQIDPNGLSFNPISDFPDTTSPKCPGRPWKSVSEINPTTQ    561 - 630
MKESYYFDLTDGLS                                                            631 - 644
//

Text Mined References (167)

PMID Year Title