Property Summary

NCBI Gene PubMed Count 150
Grant Count 840
R01 Count 561
Funding $91,287,283.9
PubMed Score 11170.73
PubTator Score 4883.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
nephrosclerosis -2.001 0.045
pancreatic ductal adenocarcinoma liver m... -2.605 0.023
psoriasis -2.100 0.000

Synonym

Accession P01042 A8K474 B2RCR2 C9JEX1 P01043 Q53EQ0 Q6PAU9 Q7M4P1
Symbols BK
BDK
KNG

Gene

PDB

1NY2   2WOK   4ASQ   4ASR   4ECB   4ECC   5I25  

Gene RIF (75)

PMID Text
26884824 KNG1 rs710446/ rs2304456 SNPs are not related to the incidence of Alzheimer's disease in a Hunan Han Chinese population.
26420021 Low urine KNG1 expression is associated with clear cell renal cell carcinoma.
26159646 The results of this study supported the association of the epistatic interactions of ALOX5AP, THBD, and KNG1 and present novel evidence for the main effect of KNG1 gene on IS susceptibility.
25766502 Bradykinin stimulates pro-contractile signalling mechanisms in human myometrial cells and arrestin proteins play key roles in their regulation.
25477429 2 genetic loci (kininogen 1 and kallikrein B) influencing key components of the RAAS, consistent with the close interrelation between the kallikrein-kinin system and the RAAS.
24984152 results demonstrate that HKa accelerates the onset of EPC senescence by stimulating JNK/FOXO4/MnSOD pathway, its effect is mediated by the HC
24688027 uPAR mediates efferocytosis through high molecular weight kininogen interaction with phosphatidylserine on apoptotic cells
24552232 Measuring plasma levels of cleaved HK may be a sensitive mean of assessing disease severity in HAE-C1-INH patients.
23874198 Data suggest factor XII binding/autoactivation are increased on surface of hantavirus-infected vascular endothelium; thus, activation of kallikrein-kinin system during hantavirus infection could have profound implications on capillary permeability.
23808406 When the concentrations of IGFBP-6 or KNG1 were greater than 98.5 pg/ml or 88.5 ng/ml, respectively, they predicted the proliferative vitreoretinopathy prognosis.
More...

AA Sequence

MKLITILFLCSRLLLSLTQESQSEEIDCNDKDLFKAVDAALKKYNSQNQSNNQFVLYRITEATKTVGSDT      1 - 70
FYSFKYEIKEGDCPVQSGKTWQDCEYKDAAKAATGECTATVGKRSSTKFSVATQTCQITPAEGPVVTAQY     71 - 140
DCLGCVHPISTQSPDLEPILRHGIQYFNNNTQHSSLFMLNEVKRAQRQVVAGLNFRITYSIVQTNCSKEN    141 - 210
FLFLTPDCKSLWNGDTGECTDNAYIDIQLRIASFSQNCDIYPGKDFVQPPTKICVGCPRDIPTNSPELEE    211 - 280
TLTHTITKLNAENNATFYFKIDNVKKARVQVVAGKKYFIDFVARETTCSKESNEELTESCETKKLGQSLD    281 - 350
CNAEVYVVPWEKKIYPTVNCQPLGMISLMKRPPGFSPFRSSRIGEIKEETTVSPPHTSMAPAQDEERDSG    351 - 420
KEQGHTRRHDWGHEKQRKHNLGHGHKHERDQGHGHQRGHGLGHGHEQQHGLGHGHKFKLDDDLEHQGGHV    421 - 490
LDHGHKHKHGHGHGKHKNKGKKNGKHNGWKTEHLASSSEDSTTPSAQTQEKTEGPTPIPSLAKPGVTVTF    491 - 560
SDFQDSDLIATMMPPISPAPIQSDDDWIPDIQIDPNGLSFNPISDFPDTTSPKCPGRPWKSVSEINPTTQ    561 - 630
MKESYYFDLTDGLS                                                            631 - 644
//

Text Mined References (161)

PMID Year Title
26884824 2015 Relationship between the gene polymorphisms of kallikrein-kinin system and Alzheimer's disease in a Hunan Han Chinese population.
26420021 2016 Proteomic analysis reveals differentially secreted proteins in the urine from patients with clear cell renal cell carcinoma.
26159646 2015 Variants in the Atherogenic ALOX5AP, THBD, and KNG1 Genes Potentiate the Risk of Ischemic Stroke via a Genetic Main Effect and Epistatic Interactions in a Chinese Population.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25766502 2015 Bradykinin-activated contractile signalling pathways in human myometrial cells are differentially regulated by arrestin proteins.
25477429 2015 Genome-wide meta-analyses of plasma renin activity and concentration reveal association with the kininogen 1 and prekallikrein genes.
24984152 2014 Cleaved high molecular weight kininogen stimulates JNK/FOXO4/MnSOD pathway for induction of endothelial progenitor cell senescence.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24688027 2014 High molecular weight kininogen binds phosphatidylserine and opsonizes urokinase plasminogen activator receptor-mediated efferocytosis.
24552232 2014 High-molecular-weight kininogen cleavage correlates with disease states in the bradykinin-mediated angioedema due to hereditary C1-inhibitor deficiency.
More...