Property Summary

NCBI Gene PubMed Count 62
PubMed Score 188.27
PubTator Score 101.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
psoriasis 6685 1.50051520866856E-130
lung carcinoma 2844 2.57631502437322E-16
chronic lymphosyte leukemia 232 1.97272655650491E-8
pilocytic astrocytoma 3086 1.97845645030968E-6
ulcerative colitis 2087 4.7009691822292E-6
malignant mesothelioma 3163 1.07857821657189E-5
osteosarcoma 7933 1.76698471701202E-5
lung adenocarcinoma 2714 5.25322838898692E-5
posterior fossa group A ependymoma 1511 7.81647166799171E-5
ovarian cancer 8492 2.52820341010061E-4
primary Sjogren syndrome 789 0.00143778231184675
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00240857135768861
pancreatic cancer 2300 0.00282251664007241
dermatomyositis 967 0.00297028809856213
lung cancer 4473 0.00675839932938418
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00699481380681022
primary pancreatic ductal adenocarcinoma 1271 0.00860377519831603
adult high grade glioma 2148 0.0145156739742942
atypical teratoid / rhabdoid tumor 4369 0.0278301496609107
cystic fibrosis and chronic rhinosinusitis 213 0.0320563654107541
uncontrolled asthma 67 0.0335265553519365
subependymal giant cell astrocytoma 2287 0.0355199969069619
Breast cancer 3099 0.0358846728737624
spina bifida 1064 0.0366642971409801
esophageal adenocarcinoma 737 0.0401141078589207
Disease Target Count Z-score Confidence
Peeling skin syndrome 16 4.805 2.4
Cancer 2346 3.481 1.7
Disease Target Count
Peeling skin syndrome 4 1

Expression

Synonym

Accession P01040 Q6IB90
Symbols AREI
PSS4
STF1
STFA

Gene

PDB

1CYU   1CYV   1DVC   1DVD   1GD3   1GD4   1N9J   1NB3   1NB5   3K9M   3KFQ   3KSE  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Mouse OMA EggNOG
Rat EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Anole lizard OMA EggNOG
Anole lizard OMA Inparanoid

 GWAS Trait (1)

Gene RIF (27)

PMID Text
26634210 Both MIP-3alpha and cystatin A overexpressions in NPC tumor tissues were strong independent factors of poor prognosis in NPC patients.
25785582 a novel pathway of CSTA regulation involving Dsg2
23656633 High levels of bioactive recombinant stefins A and B can be produced by fermentation in P. pastoris.
23546957 Data indicate that desmoplakin (DSP) and cystatin A (CSTA) interaction and insulin-like growth factor 1 (IGF-1), IGF-binding protein 7 (IGFBP7) and syndecan 1 (SDC1) interaction were observed in protein-protein interaction (PPI) network.
23534700 We identified a homozygous nonsense mutation (p.Lys22X) in the CSTA gene in acral peeling skin syndrome.
22787201 Imiquimod suppresses propagation of herpes simplex virus 1 by upregulation of cystatin A via the adenosine receptor A1 pathway
22615763 findings provide a new molecular understanding of the mechanisms of MYOC-causative glaucoma and reveal CSTA, a serum biomarker for cancer, as a potential biomarker and drug for the treatment of MYOC-induced glaucoma
21944047 study identified loss-of-function mutations in the gene for protease inhibitor cystatin A as the underlying genetic cause of exfoliative ichthyosis
21412248 CSTA significantly increases the risk of developing psoriasis in HLA-Cw6 individuals
21325429 Findings establish that genetic variability, smoking, and COPD all influence CSTA expression, as does SCC, supporting the concept that CSTA may make pivotal contributions to NSCLC pathogenesis in early and late stages of disease development.
More...

AA Sequence

MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVF      1 - 70
KSLPGQNEDLVLTGYQVDKNKDDELTGF                                               71 - 98
//

Text Mined References (66)

PMID Year Title
26634210 2015 Expression and Prognostic Significance of Macrophage Inflammatory Protein-3 Alpha and Cystatin A in Nasopharyngeal Carcinoma.
25785582 2015 Cell cycle- and cancer-associated gene networks activated by Dsg2: evidence of cystatin A deregulation and a potential role in cell-cell adhesion.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23656633 Functional expression of amyloidogenic human stefins A and B in Pichia pastoris using codon optimization.
23546957 2013 Protein interaction and microRNA network analysis in osteoarthritis meniscal cells.
23534700 Acral peeling skin syndrome resulting from a homozygous nonsense mutation in the CSTA gene encoding cystatin A.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22787201 2012 Imiquimod suppresses propagation of herpes simplex virus 1 by upregulation of cystatin A via the adenosine receptor A1 pathway.
22615763 2012 Cystatin a, a potential common link for mutant myocilin causative glaucoma.
More...