Property Summary

NCBI Gene PubMed Count 62
Grant Count 24
R01 Count 15
Funding $1,708,918.2
PubMed Score 188.27
PubTator Score 101.59

Knowledge Summary

Patent

No data available

Expression

Gene RIF (27)

PMID Text
26634210 Both MIP-3alpha and cystatin A overexpressions in NPC tumor tissues were strong independent factors of poor prognosis in NPC patients.
25785582 a novel pathway of CSTA regulation involving Dsg2
23656633 High levels of bioactive recombinant stefins A and B can be produced by fermentation in P. pastoris.
23546957 Data indicate that desmoplakin (DSP) and cystatin A (CSTA) interaction and insulin-like growth factor 1 (IGF-1), IGF-binding protein 7 (IGFBP7) and syndecan 1 (SDC1) interaction were observed in protein-protein interaction (PPI) network.
23534700 We identified a homozygous nonsense mutation (p.Lys22X) in the CSTA gene in acral peeling skin syndrome.
22787201 Imiquimod suppresses propagation of herpes simplex virus 1 by upregulation of cystatin A via the adenosine receptor A1 pathway
22615763 findings provide a new molecular understanding of the mechanisms of MYOC-causative glaucoma and reveal CSTA, a serum biomarker for cancer, as a potential biomarker and drug for the treatment of MYOC-induced glaucoma
21944047 study identified loss-of-function mutations in the gene for protease inhibitor cystatin A as the underlying genetic cause of exfoliative ichthyosis
21412248 CSTA significantly increases the risk of developing psoriasis in HLA-Cw6 individuals
21325429 Findings establish that genetic variability, smoking, and COPD all influence CSTA expression, as does SCC, supporting the concept that CSTA may make pivotal contributions to NSCLC pathogenesis in early and late stages of disease development.
More...

AA Sequence

MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVF      1 - 70
KSLPGQNEDLVLTGYQVDKNKDDELTGF                                               71 - 98
//

Text Mined References (66)

PMID Year Title
26634210 2015 Expression and Prognostic Significance of Macrophage Inflammatory Protein-3 Alpha and Cystatin A in Nasopharyngeal Carcinoma.
25785582 2015 Cell cycle- and cancer-associated gene networks activated by Dsg2: evidence of cystatin A deregulation and a potential role in cell-cell adhesion.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23656633 Functional expression of amyloidogenic human stefins A and B in Pichia pastoris using codon optimization.
23546957 2013 Protein interaction and microRNA network analysis in osteoarthritis meniscal cells.
23534700 Acral peeling skin syndrome resulting from a homozygous nonsense mutation in the CSTA gene encoding cystatin A.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22787201 2012 Imiquimod suppresses propagation of herpes simplex virus 1 by upregulation of cystatin A via the adenosine receptor A1 pathway.
22615763 2012 Cystatin a, a potential common link for mutant myocilin causative glaucoma.
More...