Property Summary

NCBI Gene PubMed Count 31
Grant Count 14
R01 Count 12
Funding $2,644,382.6
PubMed Score 27.41
PubTator Score 40.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (9)

PMID Text
25648368 high expression of Cystatin SN is a significant prognostic indicator of a higher rate of recurrence, metastatic risk, and poor survival in patients with surgically resected NSCLCs.
25577248 In conclusion, our data suggest that CST1 might contribute to the proliferation of pancreatic cancer cells and could be a potential biomarker for the early detection of pancreatic cancer.
23950865 CST1 may contribute to inactivation of protease allergens and help re-establish homeostasis of the nasal membranes.
21636832 CST1 expression at both the messenger RNA and protein levels was barely detected in control cells, which included early passage proliferating, quiescent, or immortal human fibroblasts
19587831 Observational study of gene-disease association. (HuGE Navigator)
19513549 Identification of Cystatin SN as a novel tumor marker for colorectal cancer.
19463800 CST1 might be highly involved in gastric tumorigenesis and regulate the proteolytic activity of cysteine proteases.
19343046 Observational study of gene-disease association. (HuGE Navigator)
15829315 Murine monoclonal antibodies were made which can distinguish between CST1 and CST2.

AA Sequence

MAQYLSTLLLLLATLAVALAWSPKEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRV      1 - 70
LRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQE     71 - 140
S//

Text Mined References (33)

PMID Year Title
25946035 2015 Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.
25648368 2015 Expression of Cystatin SN significantly correlates with recurrence, metastasis, and survival duration in surgically resected non-small cell lung cancer patients.
25577248 2015 Identification of cystatin SN as a novel biomarker for pancreatic cancer.
25416956 2014 A proteome-scale map of the human interactome network.
24248522 2014 Salivary protein profiles are linked to bitter taste acceptance in infants.
23950865 2013 Cystatin SN upregulation in patients with seasonal allergic rhinitis.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
21636832 2011 Novel expression of CST1 as candidate senescence marker.
20189825 2010 Confident assignment of intact mass tags to human salivary cystatins using top-down Fourier-transform ion cyclotron resonance mass spectrometry.
More...