Property Summary

NCBI Gene PubMed Count 34
PubMed Score 33.01
PubTator Score 40.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
diabetes mellitus 1.300 6.6e-03
ductal carcinoma in situ 2.900 4.2e-02
invasive ductal carcinoma 1.475 2.3e-02
lung adenocarcinoma 2.500 3.9e-09
lung cancer 4.500 2.2e-07
non-inflammatory breast cancer 1.500 6.7e-03
non-small cell lung cancer 2.241 2.2e-10
pancreatic cancer 2.500 9.0e-04
primary pancreatic ductal adenocarcinoma 3.091 1.1e-02
psoriasis -1.100 2.2e-04
Rhinitis 5.800 5.1e-06
rhinitis with controlled asthma 6.800 1.1e-05

Gene RIF (12)

AA Sequence

MAQYLSTLLLLLATLAVALAWSPKEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRV      1 - 70
LRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQE     71 - 140
S//

Text Mined References (36)

PMID Year Title