Property Summary

NCBI Gene PubMed Count 34
PubMed Score 57.18
PubTator Score 39.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung cancer 4740 4.4e-05
pancreatic cancer 2398 2.2e-02
primary pancreatic ductal adenocarcinoma 1109 2.2e-02
psoriasis 6694 2.4e-02
colon cancer 1478 2.6e-02
Disease Target Count Z-score Confidence
Kidney disease 430 0.0 3.0
Disease Target Count Z-score Confidence
Dental caries 164 3.691 1.8
progressive myoclonus epilepsy 12 3.125 1.6

Gene RIF (1)

AA Sequence

MARPLCTLLLLMATLAGALASSSKEENRIIPGGIYDADLNDEWVQRALHFAISEYNKATEDEYYRRPLQV      1 - 70
LRAREQTFGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWEDRMSLVNSRCQE     71 - 140
A//

Text Mined References (37)

PMID Year Title