Property Summary

NCBI Gene PubMed Count 33
Grant Count 49
R01 Count 27
Funding $3,636,060.16
PubMed Score 50.58
PubTator Score 39.00

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
24261636 Findings suggest the mechanism of inhibition of SAP-1 (an N-terminal truncated form of cystatin S) for different proteases.

AA Sequence

MARPLCTLLLLMATLAGALASSSKEENRIIPGGIYDADLNDEWVQRALHFAISEYNKATEDEYYRRPLQV      1 - 70
LRAREQTFGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWEDRMSLVNSRCQE     71 - 140
A//

Text Mined References (36)

PMID Year Title
25946035 2015 Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.
24952865 2014 Polymorphism of the cystatin C gene in patients with acute coronary syndromes: Results from the PLATelet inhibition and patient Outcomes study.
24261636 2015 Studies on the interactions of SAP-1 (an N-terminal truncated form of cystatin S) with its binding partners by CD-spectroscopic and molecular docking methods.
24248522 2014 Salivary protein profiles are linked to bitter taste acceptance in infants.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
20383146 2010 New loci associated with kidney function and chronic kidney disease.
20189825 2010 Confident assignment of intact mass tags to human salivary cystatins using top-down Fourier-transform ion cyclotron resonance mass spectrometry.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
More...