Property Summary

NCBI Gene PubMed Count 457
PubMed Score 3278.83
PubTator Score 2883.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Kidney disease 430 6.945 3.5
Disease Target Count Z-score Confidence
Amyloidosis 67 4.903 2.5
Age related macular degeneration 72 0.0 4.0

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma 1.900 1.7e-04
atypical teratoid / rhabdoid tumor 1.400 1.5e-04
chronic lymphosyte leukemia -2.900 2.4e-13
ependymoma 1.300 5.3e-05
gastric cancer -1.200 1.4e-02
glioblastoma 1.400 1.3e-04
group 3 medulloblastoma -2.900 5.6e-06
intraductal papillary-mucinous neoplasm ... 1.800 3.5e-03
medulloblastoma, large-cell -2.100 3.7e-05
non-small cell lung cancer -1.028 8.4e-16
osteosarcoma -1.408 1.0e-02
ovarian cancer -2.700 2.8e-10
pancreatic cancer -1.100 2.3e-02
pancreatic carcinoma -1.100 2.3e-02
primitive neuroectodermal tumor -1.300 3.0e-02
tuberculosis 1.700 1.5e-04

Gene RIF (428)

AA Sequence

MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHS      1 - 70
RALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSK     71 - 140
STCQDA                                                                    141 - 146
//

Text Mined References (467)

PMID Year Title