Property Summary

NCBI Gene PubMed Count 413
Grant Count 351
R01 Count 143
Funding $60,505,438.99
PubMed Score 3020.70
PubTator Score 2883.86

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P01034 B2R5J9 D3DW42 Q6FGW9
Symbols ARMD11
HEL-S-2

Gene

PDB

1G96   1R4C   1TIJ   3GAX   3NX0   3PS8   3QRD   3S67   3SVA  

Gene RIF (388)

PMID Text
27012051 Corticosteroids given to heart failure patients can elevate serum cystatin C levels.
27012045 Serum cystatin C may correlate with post-transplant kidney function.
26904684 High activity of cathepsin B and increased level of cystatin C are typical for women in late pregnancy. Those levels significantly decrease after delivery which can be associated with potential role of those markers in placental separation
26865059 the role of the cystatin C signal peptide in pathogenesis of AD and AMD
26845025 the A25T polymorphism does not cause a significant reduction in Cystatin C secretion, but instead predisposes the protein to be cleaved at an alternative signal sequence cleavage site.
26757339 Cystatin C expression was significantly downregulated in breast cancer cells with p53 mutations, and decreased cystatin C expression was associated with poor prognosis of breast cancer.
26710332 Cystatin C demonstrated incremental benefit in the prediction of response to cardiac resynchronization therapy.
26642700 Cystatin C may have a role in high blood pressure in elderly Chinese diabetics
26632077 findings suggest that both NGAL and CysC are very sensitive markers that reflect renal impairment in newly diagnosed patients with multiple myeloma.
26629900 Plasma Levels of Middle Molecules to Estimate Residual Kidney Function in Haemodialysis
More...

AA Sequence

MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHS      1 - 70
RALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSK     71 - 140
STCQDA                                                                    141 - 146
//

Text Mined References (423)

PMID Year Title
27012051 2016 Corticosteroids Significantly Increase Serum Cystatin C Concentration without Affecting Renal Function in Symptomatic Heart Failure.
27012045 2016 Serum Neutrophil Gelatinase-Associated Lipocalin and Cystatin C for Assessing Recovery of Graft Function in Patients Undergoing Living-Donor Kidney Transplantation.
26904684 2016 Activity of Proteolytic Enzymes and Level of Cystatin C in the Peripartum Period.
26865059 2016 Amyloid properties of the leader peptide of variant B cystatin C: implications for Alzheimer and macular degeneration.
26845025 2016 Evidence of Alternative Cystatin C Signal Sequence Cleavage Which Is Influenced by the A25T Polymorphism.
26757339 2016 Cystatin C as a p53-inducible apoptotic mediator that regulates cathepsin L activity.
26710332 2016 Incremental value of cystatin C over conventional renal metrics for predicting clinical response and outcomes in cardiac resynchronization therapy: The BIOCRT study.
26642700 2015 Association Between Serum Cystatin C and High Blood Pressure (HBP): A Cross-Sectional Study of an Elder Chinese Type 2 Diabetic Population.
26632077 2016 Neutrophil Gelatinase--Associated Lipocalin and Cystatin C Are Sensitive Markers of Renal Injury in Patients With Multiple Myeloma.
26629900 2015 Plasma Levels of Middle Molecules to Estimate Residual Kidney Function in Haemodialysis without Urine Collection.
More...