Property Summary

NCBI Gene PubMed Count 572
PubMed Score 3714.77
PubTator Score 2273.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (31)

Disease log2 FC p
diabetes mellitus -1.700 4.8e-02
active Crohn's disease 2.591 1.3e-03
active ulcerative colitis 4.292 2.0e-03
acute quadriplegic myopathy 1.981 1.2e-06
adult high grade glioma 1.800 1.6e-03
Astrocytoma, Pilocytic 2.900 6.7e-10
autosomal dominant Emery-Dreifuss muscul... 1.232 4.7e-03
Barrett's esophagus 1.600 3.9e-02
Becker muscular dystrophy 1.968 3.0e-05
colon cancer 1.300 3.5e-04
Duchenne muscular dystrophy 2.538 2.6e-12
ductal carcinoma in situ 1.100 1.7e-03
ependymoma 1.600 1.1e-04
esophageal adenocarcinoma 2.400 1.8e-02
gastric carcinoma 3.200 2.9e-03
glioblastoma 2.400 6.9e-08
interstitial cystitis 1.700 7.0e-05
invasive ductal carcinoma 1.200 6.6e-04
juvenile dermatomyositis 2.592 8.8e-13
limb girdle muscular dystrophy 2A 2.108 1.0e-09
lung adenocarcinoma 1.300 2.2e-13
lung cancer 2.200 6.2e-04
malignant mesothelioma -1.800 1.1e-07
non diabetic and post-ischemic heart fai... -1.300 2.8e-02
osteosarcoma 1.788 7.5e-04
ovarian cancer -4.000 1.4e-11
pancreatic cancer 1.300 2.3e-03
primary pancreatic ductal adenocarcinoma 2.787 5.9e-05
sonic hedgehog group medulloblastoma 1.100 1.8e-02
subependymal giant cell astrocytoma 2.470 2.3e-02
tuberculosis -2.300 2.1e-07

Protein-protein Interaction (1)

Gene RIF (551)

AA Sequence

MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYK      1 - 70
GFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFT     71 - 140
KTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA       141 - 207
//

Text Mined References (581)

PMID Year Title