Property Summary

NCBI Gene PubMed Count 539
Grant Count 584
R01 Count 374
Funding $59,440,017.84
PubMed Score 3513.40
PubTator Score 2273.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (65)

Disease Z-score Confidence
Cancer 2,346 5.558 2.8
Vascular disease 281 5.293 2.6
Arthritis 248 5.209 2.6
Periodontal disease 37 4.705 2.4
Lung disease 132 4.679 2.3
Liver disease 219 4.51 2.3
Heart disease 279 4.347 2.2
Kidney disease 396 4.171 2.1
Degenerative disc disease 28 3.935 2.0
Asthma 349 3.807 1.9
Endometriosis 535 3.476 1.7
diabetes mellitus 1,663 3.461 1.7
Glaucoma 134 3.341 1.7
Multiple Sclerosis 498 3.322 1.7
Systemic scleroderma 66 3.316 1.7
Keratoconus 47 3.259 1.6
Hepatitis C 90 3.246 1.6
Ureteral disease 23 3.04 1.5
Aortic valve insufficiency 22
Barrett's esophagus 183
Becker muscular dystrophy 187
Calcinosis 62
Diabetes Mellitus, Experimental 106
Diabetes Mellitus, Non-Insulin-Dependent 157
Duchenne muscular dystrophy 602
Female Urogenital Diseases 18
Heart Diseases 42
Heart valve disease 24
Hepatolenticular Degeneration 24
IGA Glomerulonephritis 454
Inflammation 109
Liver Cirrhosis, Alcoholic 16
Liver Cirrhosis, Experimental 108
Neoplasm Invasiveness 127
Oral Submucous Fibrosis 18
Pulmonary Fibrosis 66
Varicosity 4
Vascular Diseases 16
X-linked recessive Emery-Dreifuss muscul... 18 
active Crohn's disease 918
active ulcerative colitis 477
acute quadriplegic myopathy 1,157
colon cancer 1,475
ductal carcinoma in situ 1,745
esophageal adenocarcinoma 737
gastric carcinoma 832
glioblastoma 5,572
interstitial cystitis 2,299
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
limb girdle muscular dystrophy 2A 156
lung adenocarcinoma 2,713
lung cancer 4,466
malignant mesothelioma 3,162
non diabetic and post-ischemic heart fai... 200 
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic cancer 2,300
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
posterior fossa group A ependymoma 1,511
primary pancreatic ductal adenocarcinoma 1,271
sonic hedgehog group medulloblastoma 1,482
subependymal giant cell astrocytoma 2,287
tuberculosis 1,557

Expression

Synonym

Accession P01033 Q14252 Q9UCU1
Symbols EPA
EPO
HCI
CLGI
TIMP
TIMP-1

Gene

PDB

1D2B   1LQN   1OO9   1UEA   2J0T   3MA2   3V96  

Gene RIF (518)

PMID Text
27089280 High TIMP1 expression is associated with Sepsis.
26973196 determined normal concentration ranges for MMP-1, MMP-2, MMP-9, TIMP-1, and ratios of concentrations of MMPs and TIMP-1 (MMP-1/TIMP-1, MMP-2/TIMP-1, MMP-9/TIMP-1) in the amniotic fluid at the first period of labor in physiological pregnancy.
26861446 Metformin simultaneously increases VEGFA and reduces CXCL10 and TIMP1 in CD34(+) cells in a model of the diabetic state combined with hypoxia to stimulate angiogenesis.
26856083 The MMP9 (A8208G) as well as TIMP1 (C5367) genetic polymorphisms are not associated with calcific aortic stenosis.
26844501 protective effect of rs4898 C allele on male Parkinson disease
26782559 MMP-1 expression is increased in intervertebral disc degeneration, with higher expression observed in more severe cases, whereas TIMP-1 expression was similarly expressed in both normal and degenerated discs.
26782378 These results suggest that in the progression of renal aging, high expression of TIMP-1 up-regulates PTEN expression indicating that PTEN and TIMP-1 are involved in the aging-associated impairment of renal angiogenesis
26730601 Data show that serum neuron-specific enolase, cytokeratin 19 fragment 21-1, pro-gastrin-releasing peptide, squamous cell carcinoma antigen, tissue inhibitor of metalloproteinase-1, and human epididymis protein 4 are not associated with brain metastases.
26722039 The CC genotype of TIMP1 rs4898 compared to the TT wild-type genotype may increase lung cancer risk in Taiwan and may serve as a marker for early detective and predictive purposes.
26718740 activation of TLR7 upregulated the expression levels of IFN-lambda1 and MMP-9 were increased by ~3 fold, whereas other genes (p53, PTEN, TIMP-1) were upregulated by ~2 fold, and VEGF was marginally upregulated after 10 min.
More...

AA Sequence

MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYK      1 - 70
GFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFT     71 - 140
KTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA       141 - 207
//

Text Mined References (548)

PMID Year Title
27089280 2016 Evaluation of New Diagnostic Biomarkers in Pediatric Sepsis: Matrix Metalloproteinase-9, Tissue Inhibitor of Metalloproteinase-1, Mid-Regional Pro-Atrial Natriuretic Peptide, and Adipocyte Fatty-Acid Binding Protein.
26973196 [Reference ranges of matrix metalloproteinase-1, -2, -9 and tissue inhibitor of matrix metalloproteinases-1 concentrations in amniotic fluid in physiological pregnancy].
26861446 2016 Metformin improves the angiogenic potential of human CD34? cells co-incident with downregulating CXCL10 and TIMP1 gene expression and increasing VEGFA under hyperglycemia and hypoxia within a therapeutic window for myocardial infarction.
26856083 2015 [MATRIX METALLOPROTEINASE 9 AND TISSUE INHIBITOR OF MATRIX METALLOPROTEINASES TYPE 1 SERUM CONCENTRATIONS AND GENETIC POLYMORPHISM IN SENILE AORTIC STENOSIS].
26844501 2016 Associations of Matrix Metalloproteinase-9 and Tissue Inhibitory Factor-1 Polymorphisms With Parkinson Disease in Taiwan.
26782559 2015 Expression profiles of MMP-1 and TIMP-1 in lumbar intervertebral disc degeneration.
26782378 2015 Effect of TIMP1 transfection on PTEN expression in human kidney proximal tubular cells.
26730601 2016 Serum Biomarkers Associated with Clinical Outcomes Fail to Predict Brain Metastases in Patients with Stage IV Non-Small Cell Lung Cancers.
26722039 2016 Association of Tissue Inhibitor of Metalloproteinase-1 Genotypes with Lung Cancer Risk in Taiwan.
26718740 2016 Activation of Toll-like receptor 7 regulates the expression of IFN-?1, p53, PTEN, VEGF, TIMP-1 and MMP-9 in pancreatic cancer cells.
More...