Property Summary

NCBI Gene PubMed Count 199
Grant Count 597
R01 Count 414
Funding $71,984,853.26
PubMed Score 154.93
PubTator Score 938.83

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P01031 Q14CJ0 Q27I61
Symbols C5D
C5a
C5b
ECLZB
CPAMD4

Gene

C5

PDB

1CFA   1KJS   1XWE   3CU7   3HQA   3HQB   3KLS   3KM9   3PRX   3PVM   4A5W   4E0S   4P39   4UU9   5HCC   5HCD   5HCE   5I5K  

Gene RIF (159)

PMID Text
26934706 C5 rs2269067 GG genotype confers risk for proliferative diabetic retinopathy of type 2 diabetes in Chinese Han population (associated with an elevated C5 mRNA expression and an increased IL-6 production)
26565031 These results identify complement activation product C5a as a priming signal for RPE cells that allows for subsequent inflammasome activation by stimuli such as lipofuscin-mediated photooxidative damage.
26487798 C5a can induce the expression of TLR4 in retinal pigment epithelial cells.
26269006 The frequencies of having more than two copies of C3 were significantly increased in Behcet's disease (BD) and Vogt-Koyanagi-Harada syndrome , whereas CNV of C5 was only associated with BD.
26230759 The C5 rs2269067 GG genotype confers risk for AAU in a Chinese population and is associated with an elevated C5 serum concentration and an increased IL-17 production.
25934649 sublingual immunotherapy for Japanese cedar pollinosis affects levels of IL-17A and complement components 3a and 5a
25907631 Data show that combined inhibition of complement 3 and 5 and CD14 antigen significantly reduced E. coli-induced cytokines.
25888260 Therapeutic efficacy of radiotherapy depends on C3a and C5a.
25818678 Elevated sC5b-9 levels are indicative of active disease in atypical hemolytic uremic syndrome.
25735751 Complement C5b-9 complex sensitizes 661W photoreceptor cells to both apoptosis and necroptosis.
More...

AA Sequence

MGLLGILCFLIFLGKTWGQEQTYVISAPKIFRVGASENIVIQVYGYTEAFDATISIKSYPDKKFSYSSGH      1 - 70
VHLSSENKFQNSAILTIQPKQLPGGQNPVSYVYLEVVSKHFSKSKRMPITYDNGFLFIHTDKPVYTPDQS     71 - 140
VKVRVYSLNDDLKPAKRETVLTFIDPEGSEVDMVEEIDHIGIISFPDFKIPSNPRYGMWTIKAKYKEDFS    141 - 210
TTGTAYFEVKEYVLPHFSVSIEPEYNFIGYKNFKNFEITIKARYFYNKVVTEADVYITFGIREDLKDDQK    211 - 280
EMMQTAMQNTMLINGIAQVTFDSETAVKELSYYSLEDLNNKYLYIAVTVIESTGGFSEEAEIPGIKYVLS    281 - 350
PYKLNLVATPLFLKPGIPYPIKVQVKDSLDQLVGGVPVTLNAQTIDVNQETSDLDPSKSVTRVDDGVASF    351 - 420
VLNLPSGVTVLEFNVKTDAPDLPEENQAREGYRAIAYSSLSQSYLYIDWTDNHKALLVGEHLNIIVTPKS    421 - 490
PYIDKITHYNYLILSKGKIIHFGTREKFSDASYQSINIPVTQNMVPSSRLLVYYIVTGEQTAELVSDSVW    491 - 560
LNIEEKCGNQLQVHLSPDADAYSPGQTVSLNMATGMDSWVALAAVDSAVYGVQRGAKKPLERVFQFLEKS    561 - 630
DLGCGAGGGLNNANVFHLAGLTFLTNANADDSQENDEPCKEILRPRRTLQKKIEEIAAKYKHSVVKKCCY    631 - 700
DGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGRLHMKTLLPVSKPEIRSYFP    701 - 770
ESWLWEVHLVPRRKQLQFALPDSLTTWEIQGVGISNTGICVADTVKAKVFKDVFLEMNIPYSVVRGEQIQ    771 - 840
LKGTVYNYRTSGMQFCVKMSAVEGICTSESPVIDHQGTKSSKCVRQKVEGSSSHLVTFTVLPLEIGLHNI    841 - 910
NFSLETWFGKEILVKTLRVVPEGVKRESYSGVTLDPRGIYGTISRRKEFPYRIPLDLVPKTEIKRILSVK    911 - 980
GLLVGEILSAVLSQEGINILTHLPKGSAEAELMSVVPVFYVFHYLETGNHWNIFHSDPLIEKQKLKKKLK    981 - 1050
EGMLSIMSYRNADYSYSVWKGGSASTWLTAFALRVLGQVNKYVEQNQNSICNSLLWLVENYQLDNGSFKE   1051 - 1120
NSQYQPIKLQGTLPVEARENSLYLTAFTVIGIRKAFDICPLVKIDTALIKADNFLLENTLPAQSTFTLAI   1121 - 1190
SAYALSLGDKTHPQFRSIVSALKREALVKGNPPIYRFWKDNLQHKDSSVPNTGTARMVETTAYALLTSLN   1191 - 1260
LKDINYVNPVIKWLSEEQRYGGGFYSTQDTINAIEGLTEYSLLVKQLRLSMDIDVSYKHKGALHNYKMTD   1261 - 1330
KNFLGRPVEVLLNDDLIVSTGFGSGLATVHVTTVVHKTSTSEEVCSFYLKIDTQDIEASHYRGYGNSDYK   1331 - 1400
RIVACASYKPSREESSSGSSHAVMDISLPTGISANEEDLKALVEGVDQLFTDYQIKDGHVILQLNSIPSS   1401 - 1470
DFLCVRFRIFELFEVGFLSPATFTVYEYHRPDKQCTMFYSTSNIKIQKVCEGAACKCVEADCGQMQEELD   1471 - 1540
LTISAETRKQTACKPEIAYAYKVSITSITVENVFVKYKATLLDIYKTGEAVAEKDSEITFIKKVTCTNAE   1541 - 1610
LVKGRQYLIMGKEALQIKYNFSFRYIYPLDSLTWIEYWPRDTTCSSCQAFLANLDEFAEDIFLNGC       1611 - 1676
//

Text Mined References (203)

PMID Year Title
26934706 2016 Association of Complement C5 Gene Polymorphisms with Proliferative Diabetic Retinopathy of Type 2 Diabetes in a Chinese Han Population.
26565031 2015 Complement Component C5a Primes Retinal Pigment Epithelial Cells for Inflammasome Activation by Lipofuscin-mediated Photooxidative Damage.
26487798 2015 C5a and toll-like receptor 4 crosstalk in retinal pigment epithelial cells.
26269006 2015 Copy number variations and gene polymorphisms of complement components in ocular Behcet's disease and Vogt-Koyanagi-Harada syndrome.
26230759 2015 Complement C5 Gene Confers Risk for Acute Anterior Uveitis.
26082779 2015 Complement System Part I - Molecular Mechanisms of Activation and Regulation.
25934649 2015 Long-term sublingual immunotherapy for Japanese cedar pollinosis and the levels of IL-17A and complement components 3a and 5a.
25907631 2015 The anti-inflammatory effect of combined complement and CD14 inhibition is preserved during escalating bacterial load.
25888260 2015 Complement is a central mediator of radiotherapy-induced tumor-specific immunity and clinical response.
25818678 2015 Soluble c5b-9 as a biomarker for complement activation in atypical hemolytic uremic syndrome.
More...