Property Summary

Ligand Count 1
NCBI Gene PubMed Count 219
PubMed Score 170.79
PubTator Score 938.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (17)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 1.0e-05
ependymoma 1.100 3.8e-02
glioblastoma 1.100 3.9e-04
intraductal papillary-mucinous adenoma (... -2.600 8.5e-04
intraductal papillary-mucinous carcinoma... -2.100 1.6e-02
intraductal papillary-mucinous neoplasm ... -2.400 1.4e-02
lung cancer -1.200 1.8e-02
malignant mesothelioma 2.500 5.3e-07
medulloblastoma 1.200 9.4e-03
non-small cell lung cancer -1.354 1.1e-06
osteosarcoma -1.554 3.3e-03
ovarian cancer -1.100 8.1e-07
pancreatic cancer -1.500 3.5e-03
pancreatic ductal adenocarcinoma liver m... -3.327 6.1e-03
primitive neuroectodermal tumor 1.200 1.3e-02
psoriasis -1.100 1.0e-02
tuberculosis 1.800 4.3e-07

Protein-protein Interaction (1)

Gene RIF (178)

AA Sequence

MGLLGILCFLIFLGKTWGQEQTYVISAPKIFRVGASENIVIQVYGYTEAFDATISIKSYPDKKFSYSSGH      1 - 70
VHLSSENKFQNSAILTIQPKQLPGGQNPVSYVYLEVVSKHFSKSKRMPITYDNGFLFIHTDKPVYTPDQS     71 - 140
VKVRVYSLNDDLKPAKRETVLTFIDPEGSEVDMVEEIDHIGIISFPDFKIPSNPRYGMWTIKAKYKEDFS    141 - 210
TTGTAYFEVKEYVLPHFSVSIEPEYNFIGYKNFKNFEITIKARYFYNKVVTEADVYITFGIREDLKDDQK    211 - 280
EMMQTAMQNTMLINGIAQVTFDSETAVKELSYYSLEDLNNKYLYIAVTVIESTGGFSEEAEIPGIKYVLS    281 - 350
PYKLNLVATPLFLKPGIPYPIKVQVKDSLDQLVGGVPVTLNAQTIDVNQETSDLDPSKSVTRVDDGVASF    351 - 420
VLNLPSGVTVLEFNVKTDAPDLPEENQAREGYRAIAYSSLSQSYLYIDWTDNHKALLVGEHLNIIVTPKS    421 - 490
PYIDKITHYNYLILSKGKIIHFGTREKFSDASYQSINIPVTQNMVPSSRLLVYYIVTGEQTAELVSDSVW    491 - 560
LNIEEKCGNQLQVHLSPDADAYSPGQTVSLNMATGMDSWVALAAVDSAVYGVQRGAKKPLERVFQFLEKS    561 - 630
DLGCGAGGGLNNANVFHLAGLTFLTNANADDSQENDEPCKEILRPRRTLQKKIEEIAAKYKHSVVKKCCY    631 - 700
DGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGRLHMKTLLPVSKPEIRSYFP    701 - 770
ESWLWEVHLVPRRKQLQFALPDSLTTWEIQGVGISNTGICVADTVKAKVFKDVFLEMNIPYSVVRGEQIQ    771 - 840
LKGTVYNYRTSGMQFCVKMSAVEGICTSESPVIDHQGTKSSKCVRQKVEGSSSHLVTFTVLPLEIGLHNI    841 - 910
NFSLETWFGKEILVKTLRVVPEGVKRESYSGVTLDPRGIYGTISRRKEFPYRIPLDLVPKTEIKRILSVK    911 - 980
GLLVGEILSAVLSQEGINILTHLPKGSAEAELMSVVPVFYVFHYLETGNHWNIFHSDPLIEKQKLKKKLK    981 - 1050
EGMLSIMSYRNADYSYSVWKGGSASTWLTAFALRVLGQVNKYVEQNQNSICNSLLWLVENYQLDNGSFKE   1051 - 1120
NSQYQPIKLQGTLPVEARENSLYLTAFTVIGIRKAFDICPLVKIDTALIKADNFLLENTLPAQSTFTLAI   1121 - 1190
SAYALSLGDKTHPQFRSIVSALKREALVKGNPPIYRFWKDNLQHKDSSVPNTGTARMVETTAYALLTSLN   1191 - 1260
LKDINYVNPVIKWLSEEQRYGGGFYSTQDTINAIEGLTEYSLLVKQLRLSMDIDVSYKHKGALHNYKMTD   1261 - 1330
KNFLGRPVEVLLNDDLIVSTGFGSGLATVHVTTVVHKTSTSEEVCSFYLKIDTQDIEASHYRGYGNSDYK   1331 - 1400
RIVACASYKPSREESSSGSSHAVMDISLPTGISANEEDLKALVEGVDQLFTDYQIKDGHVILQLNSIPSS   1401 - 1470
DFLCVRFRIFELFEVGFLSPATFTVYEYHRPDKQCTMFYSTSNIKIQKVCEGAACKCVEADCGQMQEELD   1471 - 1540
LTISAETRKQTACKPEIAYAYKVSITSITVENVFVKYKATLLDIYKTGEAVAEKDSEITFIKKVTCTNAE   1541 - 1610
LVKGRQYLIMGKEALQIKYNFSFRYIYPLDSLTWIEYWPRDTTCSSCQAFLANLDEFAEDIFLNGC       1611 - 1676
//

Text Mined References (223)

PMID Year Title