Property Summary

NCBI Gene PubMed Count 474
Grant Count 304
R01 Count 187
Funding $41,299,914.65
PubMed Score 3337.10
PubTator Score 4193.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (74)

Disease Z-score Confidence
Lupus erythematosus 80 5.389 2.7
Kidney disease 396 5.174 2.6
Anemia 252 4.756 2.4
Congenital afibrinogenemia 9 4.694 2.3
Complement deficiency 15 4.444 2.2
Age related macular degeneration 84 4.14 2.1
Rheumatoid Arthritis 1,160 3.915 2.0
Vascular disease 281 3.836 1.9
Cancer 2,346 3.657 1.8
Skin disease 65 3.643 1.8
Autoimmune hemolytic anemia 17 3.445 1.7
Tetanus 66 3.338 1.7
Relapsing fever 16 3.269 1.6
Henoch-Schoenlein purpura 13 3.21 1.6
Meningitis 46 3.156 1.6
Myasthenia Gravis 26 3.134 1.6
Thrombocytopenia 105 3.11 1.6
Malaria 140 3.068 1.5
Atypical Hemolytic Uremic Syndrome 9
Becker muscular dystrophy 187
C3 Deficiency 1
COMPLEMENT COMPONENT 3 DEFICIENCY, AUTOS... 1 
Carcinoma 2,147 1.0
Diabetes Mellitus, Non-Insulin-Dependent 157
Down syndrome 548
Drug-Induced Liver Injury 118
Duchenne muscular dystrophy 602
Gaucher disease type 3 76
HEMOLYTIC UREMIC SYNDROME, ATYPICAL, SUS... 1 
Immunologic Deficiency Syndromes 16
Infarction, Middle Cerebral Artery 25
Insulin Resistance 48
Macular Degeneration, Age-Related, 9 1
Macular degeneration 41 2.0
Paratuberculosis 6
Pemphigus 18
Transient Ischemic Attack 10
acute quadriplegic myopathy 1,157
adrenocortical carcinoma 1,427
aldosterone-producing adenoma 664
astrocytoma 1,493
atypical teratoid / rhabdoid tumor 4,369
autosomal dominant Emery-Dreifuss muscul... 499 
chronic kidney disease 90
colon cancer 1,475
cystic fibrosis 1,665
dermatomyositis 933
diabetes mellitus 1,663
gastric carcinoma 832
glioblastoma 5,572
group 4 medulloblastoma 1,875
head and neck cancer and chronic obstruc... 237 
hemolytic-uremic syndrome 28 4.0
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
limb girdle muscular dystrophy 2A 156
lung cancer 4,466
lung carcinoma 2,844
malignant mesothelioma 3,162
medulloblastoma, large-cell 6,234
non diabetic and post-ischemic heart fai... 200 
non-small cell lung cancer 2,798
ovarian cancer 8,484
periodontitis 269
pilocytic astrocytoma 3,086
posterior fossa group A ependymoma 1,511
primary Sjogren syndrome 789
primary pancreatic ductal adenocarcinoma 1,271
psoriasis 6,685
subependymal giant cell astrocytoma 2,287
tuberculosis 1,557
ulcerative colitis 2,087

Expression

  Differential Expression (40)

Disease log2 FC p
malignant mesothelioma -5.300 0.000
astrocytoma 2.700 0.004
psoriasis -1.100 0.007
glioblastoma 2.000 0.005
group 4 medulloblastoma -2.300 0.000
cystic fibrosis 1.343 0.002
non diabetic and post-ischemic heart fai... -1.100 0.042
periodontitis 1.200 0.000
atypical teratoid / rhabdoid tumor -1.900 0.003
medulloblastoma, large-cell -3.200 0.000
Duchenne muscular dystrophy 2.153 0.000
limb girdle muscular dystrophy 2A 1.732 0.000
autosomal dominant Emery-Dreifuss muscul... 1.112 0.023
Becker muscular dystrophy 1.046 0.008
juvenile dermatomyositis 1.068 0.000
acute quadriplegic myopathy 1.586 0.000
adrenocortical carcinoma -2.666 0.012
chronic kidney disease 2.300 0.007
tuberculosis -1.200 0.000
primary pancreatic ductal adenocarcinoma 1.067 0.004
non-small cell lung cancer -1.286 0.000
intraductal papillary-mucinous adenoma (... -2.900 0.002
intraductal papillary-mucinous carcinoma... -3.100 0.005
lung cancer -6.500 0.000
colon cancer -2.300 0.004
diabetes mellitus -1.400 0.017
pilocytic astrocytoma 1.700 0.000
posterior fossa group A ependymoma 1.100 0.017
primary Sjogren syndrome 2.200 0.009
aldosterone-producing adenoma -1.893 0.048
subependymal giant cell astrocytoma 2.373 0.006
lung carcinoma -4.400 0.000
gastric carcinoma 2.900 0.005
invasive ductal carcinoma -1.500 0.003
ulcerative colitis 2.400 0.000
ovarian cancer 4.200 0.000
Gaucher disease type 3 -1.700 0.035
Down syndrome 1.400 0.008
dermatomyositis 1.200 0.014
head and neck cancer and chronic obstruc... 1.300 0.010

Synonym

Accession P01024 A7E236
Symbols ASP
C3a
C3b
AHUS5
ARMD9
CPAMD1
HEL-S-62p

Gene

C3

PDB

5FO9   1C3D   1GHQ   1W2S   2A73   2A74   2GOX   2I07   2ICE   2ICF   2NOJ   2QKI   2WII   2WIN   2WY7   2WY8   2XQW   2XWB   2XWJ   3D5R   3D5S   3G6J   3L3O   3L5N   3NMS   3OED   3OHX   3OXU   3RJ3   3T4A   4HW5   4HWJ   4I6O   4M76   4ONT   4ZH1   5FO7   5FO8   5FOA   5FOB  

Gene RIF (401)

PMID Text
26945067 These results suggest that GAS utilizes diverse mechanisms to degrade C3b and thus to protect bacterial cells from the complement response of the host.
26897815 C4BP is deposited in the diseased aortic valve, coincident with C3d expression.
26767664 Patients with advanced atrophic AMD carried these rare variants more frequently than patients with neovascular AMD (11 of 93 [11.8%] vs 40 of 835 [4.8%]; P = .04).
26718342 Our results identified TWIST1 as a transcription factor that regulates C3 expression during pathologic and physiologic epithelial-mesenchymal transition
26542163 Low sC3 levels and histologic signs of thrombotic microangiopathy are associated with a poor renal prognosis in patients with ANCA-associated renal vasculitis.
26523990 Higher C3 was significantly associated with presence and greater extent of arterial calcification in midlife women. These associations were explained by higher volumes of cardiovascular fat, suggesting CF as a potential source of C3.
26505407 The aim of this study was to perform a meta-analysis on rs2230199 C>G single nucleotide polymorphism (SNP) in complement component 3P in relation to AMD
26408241 Glomerulonephritis with Dominant C can progress to ESRD.
26400934 The results of this study suggest that complement C3, or its downstream signaling, is detrimental to synapses during aging.
26305563 the results of this study do not support C3 as a major genetic susceptibility factor in schizophrenia.
More...

AA Sequence

MGPTSGPSLLLLLLTHLPLALGSPMYSIITPNILRLESEETMVLEAHDAQGDVPVTVTVHDFPGKKLVLS      1 - 70
SEKTVLTPATNHMGNVTFTIPANREFKSEKGRNKFVTVQATFGTQVVEKVVLVSLQSGYLFIQTDKTIYT     71 - 140
PGSTVLYRIFTVNHKLLPVGRTVMVNIENPEGIPVKQDSLSSQNQLGVLPLSWDIPELVNMGQWKIRAYY    141 - 210
ENSPQQVFSTEFEVKEYVLPSFEVIVEPTEKFYYIYNEKGLEVTITARFLYGKKVEGTAFVIFGIQDGEQ    211 - 280
RISLPESLKRIPIEDGSGEVVLSRKVLLDGVQNPRAEDLVGKSLYVSATVILHSGSDMVQAERSGIPIVT    281 - 350
SPYQIHFTKTPKYFKPGMPFDLMVFVTNPDGSPAYRVPVAVQGEDTVQSLTQGDGVAKLSINTHPSQKPL    351 - 420
SITVRTKKQELSEAEQATRTMQALPYSTVGNSNNYLHLSVLRTELRPGETLNVNFLLRMDRAHEAKIRYY    421 - 490
TYLIMNKGRLLKAGRQVREPGQDLVVLPLSITTDFIPSFRLVAYYTLIGASGQREVVADSVWVDVKDSCV    491 - 560
GSLVVKSGQSEDRQPVPGQQMTLKIEGDHGARVVLVAVDKGVFVLNKKNKLTQSKIWDVVEKADIGCTPG    561 - 630
SGKDYAGVFSDAGLTFTSSSGQQTAQRAELQCPQPAARRRRSVQLTEKRMDKVGKYPKELRKCCEDGMRE    631 - 700
NPMRFSCQRRTRFISLGEACKKVFLDCCNYITELRRQHARASHLGLARSNLDEDIIAEENIVSRSEFPES    701 - 770
WLWNVEDLKEPPKNGISTKLMNIFLKDSITTWEILAVSMSDKKGICVADPFEVTVMQDFFIDLRLPYSVV    771 - 840
RNEQVEIRAVLYNYRQNQELKVRVELLHNPAFCSLATTKRRHQQTVTIPPKSSLSVPYVIVPLKTGLQEV    841 - 910
EVKAAVYHHFISDGVRKSLKVVPEGIRMNKTVAVRTLDPERLGREGVQKEDIPPADLSDQVPDTESETRI    911 - 980
LLQGTPVAQMTEDAVDAERLKHLIVTPSGCGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIK    981 - 1050
KGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQE   1051 - 1120
DAPVIHQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVA   1121 - 1190
IAGYALAQMGRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQR   1191 - 1260
YYGGGYGSTQATFMVFQALAQYQKDAPDHQELNLDVSLQLPSRSSKITHRIHWESASLLRSEETKENEGF   1261 - 1330
TVTAEGKGQGTLSVVTMYHAKAKDQLTCNKFDLKVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDATM   1331 - 1400
SILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVE   1401 - 1470
LIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQKSDDKVTLEERLDKACEPG   1471 - 1540
VDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSD   1541 - 1610
FWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN                    1611 - 1663
//

Text Mined References (489)

PMID Year Title
26945067 2016 Streptococcus pyogenes Employs Strain-dependent Mechanisms of C3b Inactivation to Inhibit Phagocytosis and Killing of Bacteria.
26897815 2015 C4b-Binding Protein Deposition is Induced in Diseased Aortic Heart Valves, Coinciding with C3d.
26767664 2016 Rare Genetic Variants Associated With Development of Age-Related Macular Degeneration.
26718342 2016 Complement Component 3 Is Regulated by TWIST1 and Mediates Epithelial-Mesenchymal Transition.
26627825 2016 Extracellular Fibrinogen-binding Protein (Efb) from Staphylococcus aureus Inhibits the Formation of Platelet-Leukocyte Complexes.
26542163 2015 Association of Serum C3 Concentration and Histologic Signs of Thrombotic Microangiopathy with Outcomes among Patients with ANCA-Associated Renal Vasculitis.
26523990 2015 Complement proteins and arterial calcification in middle aged women: Cross-sectional effect of cardiovascular fat. The SWAN Cardiovascular Fat Ancillary Study.
26505407 2015 Association between a functional genetic polymorphism (rs2230199) and age-related macular degeneration risk: a meta-analysis.
26408241 2015 AJKD Atlas of Renal Pathology: Glomerulonephritis With Dominant C3.
26400934 2015 Complement C3-Deficient Mice Fail to Display Age-Related Hippocampal Decline.
More...