Property Summary

NCBI Gene PubMed Count 206
Grant Count 131
R01 Count 76
Funding $13,121,604.43
PubMed Score 802.67
PubTator Score 2462.93

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P01023 Q13677 Q59F47 Q5QTS0 Q68DN2 Q6PIY3 Q6PN97 Alpha-2-M
Symbols A2MD
CPAMD5
FWP007
S863-7

Gene

A2M

PDB

1BV8   2P9R   4ACQ  

Gene RIF (141)

PMID Text
27044074 These data demonstrate that alpha2M* and LRP1 modulate the BKCachannel in human myometrium and that BKCaand its immunomodulatory interacting partners regulate Ca(2+)dynamics in hMSMCs during pregnancy.
27002159 This work demonstrates that alpha2M*/CS-GRP78 acts as an upstream regulator of the PDK1/PLK1 signaling axis to modulate c-MYC transcription and its target genes, suggesting a therapeutic strategy for targeting c-MYC-associated malignant progression.
26217017 Alpha2M causes neurodegeneration in a p75(NTR)- and proNGF-dependent manner.
26134405 we identify a single serum factor, alpha2-macroglobulin (alpha2M), which is both required and sufficient for rosetting mediated by the parasite protein P. falciparum erythrocyte membrane protein 1 protein HB3VAR06 and some other rosette-mediating PfEMP1 proteins
25867373 Data indicate that the expression of salivary alpha2 macroglobulin (alpha2-M) showed a remarkable increase in type 2 diabetes mellitus (T2DM), which may be associated with functional disorders of the salivary gland.
25809189 A2M is expressed in the vasculature and NR4A receptors modulate VSMC MMP2/9 activity by several mechanisms including the up-regulation of A2M.
25574746 A2M is not the only biological candidate gene for AD determination
25495992 Meta-analysis. Our data indicate that the rs669 (A/G) polymorphisms in A2M gene are associated with increased risk in Parkinson disease.
24799681 alpha2M is a specialized chaperone that prevents the extracellular accumulation of misfolded and potentially pathogenic proteins, particularly during innate immune system activity
24756728 there is no enough evidence for associations of A2M gene polymorphisms (5 bp I/D, Ile1000Val) with Alzheimer's disease risk
More...

AA Sequence

MGKNKLLHPSLVLLLLVLLPTDASVSGKPQYMVLVPSLLHTETTEKGCVLLSYLNETVTVSASLESVRGN      1 - 70
RSLFTDLEAENDVLHCVAFAVPKSSSNEEVMFLTVQVKGPTQEFKKRTTVMVKNEDSLVFVQTDKSIYKP     71 - 140
GQTVKFRVVSMDENFHPLNELIPLVYIQDPKGNRIAQWQSFQLEGGLKQFSFPLSSEPFQGSYKVVVQKK    141 - 210
SGGRTEHPFTVEEFVLPKFEVQVTVPKIITILEEEMNVSVCGLYTYGKPVPGHVTVSICRKYSDASDCHG    211 - 280
EDSQAFCEKFSGQLNSHGCFYQQVKTKVFQLKRKEYEMKLHTEAQIQEEGTVVELTGRQSSEITRTITKL    281 - 350
SFVKVDSHFRQGIPFFGQVRLVDGKGVPIPNKVIFIRGNEANYYSNATTDEHGLVQFSINTTNVMGTSLT    351 - 420
VRVNYKDRSPCYGYQWVSEEHEEAHHTAYLVFSPSKSFVHLEPMSHELPCGHTQTVQAHYILNGGTLLGL    421 - 490
KKLSFYYLIMAKGGIVRTGTHGLLVKQEDMKGHFSISIPVKSDIAPVARLLIYAVLPTGDVIGDSAKYDV    491 - 560
ENCLANKVDLSFSPSQSLPASHAHLRVTAAPQSVCALRAVDQSVLLMKPDAELSASSVYNLLPEKDLTGF    561 - 630
PGPLNDQDNEDCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGP    631 - 700
EGLRVGFYESDVMGRGHARLVHVEEPHTETVRKYFPETWIWDLVVVNSAGVAEVGVTVPDTITEWKAGAF    701 - 770
CLSEDAGLGISSTASLRAFQPFFVELTMPYSVIRGEAFTLKATVLNYLPKCIRVSVQLEASPAFLAVPVE    771 - 840
KEQAPHCICANGRQTVSWAVTPKSLGNVNFTVSAEALESQELCGTEVPSVPEHGRKDTVIKPLLVEPEGL    841 - 910
EKETTFNSLLCPSGGEVSEELSLKLPPNVVEESARASVSVLGDILGSAMQNTQNLLQMPYGCGEQNMVLF    911 - 980
APNIYVLDYLNETQQLTPEIKSKAIGYLNTGYQRQLNYKHYDGSYSTFGERYGRNQGNTWLTAFVLKTFA    981 - 1050
QARAYIFIDEAHITQALIWLSQRQKDNGCFRSSGSLLNNAIKGGVEDEVTLSAYITIALLEIPLTVTHPV   1051 - 1120
VRNALFCLESAWKTAQEGDHGSHVYTKALLAYAFALAGNQDKRKEVLKSLNEEAVKKDNSVHWERPQKPK   1121 - 1190
APVGHFYEPQAPSAEVEMTSYVLLAYLTAQPAPTSEDLTSATNIVKWITKQQNAQGGFSSTQDTVVALHA   1191 - 1260
LSKYGAATFTRTGKAAQVTIQSSGTFSSKFQVDNNNRLLLQQVSLPELPGEYSMKVTGEGCVYLQTSLKY   1261 - 1330
NILPEKEEFPFALGVQTLPQTCDEPKAHTSFQISLSVSYTGSRSASNMAIVDVKMVSGFIPLKPTVKMLE   1331 - 1400
RSNHVSRTEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVRDLKPAIVKVYDYYETDEFAIAEYNAPCSKD   1401 - 1470
LGNA                                                                     1471 - 1474
//

Text Mined References (212)

PMID Year Title
27872486 2017 Alpha-2 macroglobulin in Alzheimer's disease: a marker of neuronal injury through the RCAN1 pathway.
27862254 2016 HK2 Proximal Tubule Epithelial Cells Synthesize and Secrete Plasma Proteins Predominantly Through the Apical Surface.
27839872 2016 Mutations in CPAMD8 Cause a Unique Form of Autosomal-Recessive Anterior Segment Dysgenesis.
27788907 2016 ?2-Macroglobulin: Autologous Protease Inhibition Technology.
27498393 2016 Quantitative proteomics revealed novel proteins associated with molecular subtypes of breast cancer.
27228572 2016 A proteomics analysis reveals that A2M might be regulated by STAT3 in persistent allergic rhinitis.
27090037 2016 Transcriptional expression profiles of the main proteinases and their regulators in coronary artery ectasia patients' mononuclear cells.
27044074 2016 BKCa channel regulates calcium oscillations induced by alpha-2-macroglobulin in human myometrial smooth muscle cells.
27031486 2016 Blood-Based Biomarker Candidates of Cerebral Amyloid Using PiB PET in Non-Demented Elderly.
27002159 2016 Activated ?2-Macroglobulin Regulates Transcriptional Activation of c-MYC Target Genes through Cell Surface GRP78 Protein.
More...