Property Summary

NCBI Gene PubMed Count 211
PubMed Score 801.95
PubTator Score 2462.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6

Expression

  Differential Expression (26)

Disease log2 FC p
adult high grade glioma 1.200 3.2e-03
astrocytic glioma 1.300 2.1e-02
Astrocytoma, Pilocytic 1.800 4.0e-09
Becker muscular dystrophy 1.349 4.3e-03
Breast cancer -1.200 1.8e-04
colon cancer -1.100 8.5e-03
Duchenne muscular dystrophy 1.383 9.2e-06
esophageal adenocarcinoma 1.300 2.5e-02
gastric carcinoma 1.600 1.8e-02
Gaucher disease type 3 -2.400 4.6e-02
glioblastoma 1.400 1.5e-06
intraductal papillary-mucinous adenoma (... -2.000 5.4e-04
intraductal papillary-mucinous carcinoma... -2.900 5.9e-04
intraductal papillary-mucinous neoplasm ... -2.700 5.6e-04
invasive ductal carcinoma -1.300 2.8e-04
lung adenocarcinoma -1.100 1.7e-07
lung cancer -2.900 1.8e-05
lung carcinoma -1.400 2.6e-11
non-small cell lung cancer -1.824 3.3e-19
oligodendroglioma 1.100 3.8e-02
ovarian cancer -1.600 1.6e-02
pancreatic ductal adenocarcinoma liver m... -2.011 1.1e-02
posterior fossa group A ependymoma 1.200 3.0e-06
pterygium 1.300 4.2e-03
subependymal giant cell astrocytoma 1.701 9.0e-03
ulcerative colitis 1.300 7.7e-04

Gene RIF (148)

AA Sequence

MGKNKLLHPSLVLLLLVLLPTDASVSGKPQYMVLVPSLLHTETTEKGCVLLSYLNETVTVSASLESVRGN      1 - 70
RSLFTDLEAENDVLHCVAFAVPKSSSNEEVMFLTVQVKGPTQEFKKRTTVMVKNEDSLVFVQTDKSIYKP     71 - 140
GQTVKFRVVSMDENFHPLNELIPLVYIQDPKGNRIAQWQSFQLEGGLKQFSFPLSSEPFQGSYKVVVQKK    141 - 210
SGGRTEHPFTVEEFVLPKFEVQVTVPKIITILEEEMNVSVCGLYTYGKPVPGHVTVSICRKYSDASDCHG    211 - 280
EDSQAFCEKFSGQLNSHGCFYQQVKTKVFQLKRKEYEMKLHTEAQIQEEGTVVELTGRQSSEITRTITKL    281 - 350
SFVKVDSHFRQGIPFFGQVRLVDGKGVPIPNKVIFIRGNEANYYSNATTDEHGLVQFSINTTNVMGTSLT    351 - 420
VRVNYKDRSPCYGYQWVSEEHEEAHHTAYLVFSPSKSFVHLEPMSHELPCGHTQTVQAHYILNGGTLLGL    421 - 490
KKLSFYYLIMAKGGIVRTGTHGLLVKQEDMKGHFSISIPVKSDIAPVARLLIYAVLPTGDVIGDSAKYDV    491 - 560
ENCLANKVDLSFSPSQSLPASHAHLRVTAAPQSVCALRAVDQSVLLMKPDAELSASSVYNLLPEKDLTGF    561 - 630
PGPLNDQDNEDCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGP    631 - 700
EGLRVGFYESDVMGRGHARLVHVEEPHTETVRKYFPETWIWDLVVVNSAGVAEVGVTVPDTITEWKAGAF    701 - 770
CLSEDAGLGISSTASLRAFQPFFVELTMPYSVIRGEAFTLKATVLNYLPKCIRVSVQLEASPAFLAVPVE    771 - 840
KEQAPHCICANGRQTVSWAVTPKSLGNVNFTVSAEALESQELCGTEVPSVPEHGRKDTVIKPLLVEPEGL    841 - 910
EKETTFNSLLCPSGGEVSEELSLKLPPNVVEESARASVSVLGDILGSAMQNTQNLLQMPYGCGEQNMVLF    911 - 980
APNIYVLDYLNETQQLTPEIKSKAIGYLNTGYQRQLNYKHYDGSYSTFGERYGRNQGNTWLTAFVLKTFA    981 - 1050
QARAYIFIDEAHITQALIWLSQRQKDNGCFRSSGSLLNNAIKGGVEDEVTLSAYITIALLEIPLTVTHPV   1051 - 1120
VRNALFCLESAWKTAQEGDHGSHVYTKALLAYAFALAGNQDKRKEVLKSLNEEAVKKDNSVHWERPQKPK   1121 - 1190
APVGHFYEPQAPSAEVEMTSYVLLAYLTAQPAPTSEDLTSATNIVKWITKQQNAQGGFSSTQDTVVALHA   1191 - 1260
LSKYGAATFTRTGKAAQVTIQSSGTFSSKFQVDNNNRLLLQQVSLPELPGEYSMKVTGEGCVYLQTSLKY   1261 - 1330
NILPEKEEFPFALGVQTLPQTCDEPKAHTSFQISLSVSYTGSRSASNMAIVDVKMVSGFIPLKPTVKMLE   1331 - 1400
RSNHVSRTEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVRDLKPAIVKVYDYYETDEFAIAEYNAPCSKD   1401 - 1470
LGNA                                                                     1471 - 1474
//

Text Mined References (217)

PMID Year Title