Property Summary

NCBI Gene PubMed Count 964
Grant Count 717
R01 Count 407
Funding $92,451,108.95
PubMed Score 1673.44
PubTator Score 10892.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (88)

Disease Z-score Confidence
Hypertension 287 6.883 3.4
Kidney disease 396 5.415 2.7
Coronary artery disease 240 4.579 2.3
diabetes mellitus 1,663 4.576 2.3
Obesity 616 4.193 2.1
Heart disease 279 3.882 1.9
Cerebrovascular disease 231 3.802 1.9
Atherosclerosis 275 3.626 1.8
Hyperaldosteronism 27 3.426 1.7
Oligohydramnios 18 3.262 1.6
Metabolic syndrome X 155 3.151 1.6
Albuminuria 20
Alkalosis 1
Allanson Pantzar McLeod syndrome 4
Anemia 252
Aneurysm, Dissecting 5
Anuria 6
Aortic Aneurysm, Abdominal 10
Aortic aneurysm 34
Bradycardia 24
Breast cancer 3,094
Cardiac Arrhythmia 20
Cardiomegaly 66
Cardiomyopathies 90
Cardiomyopathy, Alcoholic 1
Cardiovascular Diseases 50
Carotid Artery Diseases 11
Catalepsy 15
Diabetes Mellitus, Experimental 106
Diabetic Nephropathy 37
Diabetic Retinopathy 53
Diaphragmatic Hernia 40
Down syndrome 548
Drug Overdose 2
Endomyocardial Fibrosis 10
Essential Hypertension 82
Fetal Growth Retardation 9
Fibrosis 40
Focal glomerulosclerosis 22
Glomerulonephritis 36
Heart Diseases 42
Heart failure 80
Hyperalgesia 71
Hyperemia 13
Hypertensive disease 193
Hypokalemia 40
Hypotension 53
IGA Glomerulonephritis 454
IgA NEPHROPATHY, PROGRESSION TO RENAL FA... 2 
Inflammation 109
Kidney Diseases 86
Left Ventricular Hypertrophy 24
Liver Cirrhosis 101
Liver Cirrhosis, Experimental 108
Malignant Hypertension 3
Myocardial Infarction 126
Myocardial Ischemia 169
Myocardial Reperfusion Injury 34
Necrosis 51
Neointima 5
Nephrosis 18
Peptic Ulcer Hemorrhage 2
Proteinuria 63
Renal Insufficiency 10
Renal hypertension 3
Reperfusion Injury 84
Retinopathy of prematurity 21
Seizures 95
Sudden death 2
Thrombosis 42
atypical teratoid/rhabdoid tumor 1,095
esophageal adenocarcinoma 737
gastric carcinoma 832
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
medulloblastoma, large-cell 6,234
pancreatic cancer 2,300
pituitary cancer 1,972
pre-eclampsia 67
primary pancreatic ductal adenocarcinoma 1,271
primitive neuroectodermal tumor 3,031
psoriasis 6,685
sonic hedgehog group medulloblastoma 1,482
subependymal giant cell astrocytoma 2,287
ulcerative colitis 2,087

Expression

Synonym

Accession P01019 Q16358 Q16359 Q96F91
Symbols ANHU
SERPINA8

Gene

AGT

PDB

5E2Q   4FYS   1N9U   1N9V   2JP8   2WXW   2X0B   3CK0   3WOO   3WOR   4AA1   4APH  

Gene RIF (1029)

PMID Text
26873967 Detection of hANG(1-12) in hearts of homozygous transgenic rats expressing the hAGT gene suggests existence of non-renin-dependent enzyme mechanism capable of cleavage of human substrate.
26825581 Results indicate that urinary angiotensinogen was associated with blood pressure elevation in this population of obese young adults.
26782563 There was an association between the AGT rs699 polymorphism and diabetes mellitus type 2 in the Brazilian patients.
26772530 Ang II induces cardiac fibrosis by enhancing DDR2 expression in cardiac fibroblasts via p38 MAPK-mediated activation of NF-kappaB.
26755736 Blood pressure was significantly lower in angiotensinogen knock-out mice compared to controls fed a normal or high sodium diet.
26682227 our analysis revealed that the associations of the AGT variants with T2DM were independently associated.
26632605 urinary AGT/protein ratio represents a novel specific marker of podocyte injury
26588355 rs699 in the AGT gene and rs5186 in the ATR1 gene were not associated with the risk and clinical outcomes of IgAN.
26556555 Polymorphisms of three genes (ACE, AGT and CYP11B2) in the renin-angiotensin-aldosterone system are not associated with blood pressure salt sensitivity. (Meta-analysis)
26505451 results of this meta-analysis suggested that the AGT A-20C polymorphism was associated with risk of essential hypertension in Asians
More...

AA Sequence

MRKRAPQSEMAPAGVSLRATILCLLAWAGLAAGDRVYIHPFHLVIHNESTCEQLAKANAGKPKDPTFIPA      1 - 70
PIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGMHSELWGVVHGATVLSPTAVF     71 - 140
GTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKVLSALQAVQGLLVAQGRADSQAQLLLSTVVG    141 - 210
VFTAPGLHLKQPFVQGLALYTPVVLPRSLDFTELDVAAEKIDRFMQAVTGWKTGCSLMGASVDSTLAFNT    211 - 280
YVHFQGKMKGFSLLAEPQEFWVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQVPFTESACLLLIQPHYA    281 - 350
SDLDKVEGLTFQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRIR    351 - 420
VGEVLNSIFFELEADEREPTESTQQLNKPEVLEVTLNRPFLFAVYDQSATALHFLGRVANPLSTA         421 - 485
//

Text Mined References (970)

PMID Year Title
26873967 2016 Cardiac angiotensin-(1-12) expression and systemic hypertension in rats expressing the human angiotensinogen gene.
26825581 2016 Urinary angiotensinogen excretion is associated with blood pressure in obese young adults.
26782563 2015 Role of ACE and AGT gene polymorphisms in genetic susceptibility to diabetes mellitus type 2 in a Brazilian sample.
26772530 2016 May the fibrosis be with you: Is discoidin domain receptor 2 the receptor we have been looking for?
26755736 2016 Possible role for nephron-derived angiotensinogen in angiotensin-II dependent hypertension.
26682227 2016 Renin-Angiotensin System Gene Variants and Type 2 Diabetes Mellitus: Influence of Angiotensinogen.
26632605 2016 Assessment of urinary angiotensinogen as a marker of podocyte injury in proteinuric nephropathies.
26588355 2015 Lack of Association Between Polymorphisms in AGT and ATR1 and IgA Nephropathy in a Chinese Population.
26556555 2016 Polymorphisms of three genes (ACE, AGT and CYP11B2) in the renin-angiotensin-aldosterone system are not associated with blood pressure salt sensitivity: A systematic meta-analysis.
26489635 2015 Effect of topical propranolol gel on plasma renin, angiotensin II and vascular endothelial growth factor in superficial infantile hemangiomas.
More...