Property Summary

NCBI Gene PubMed Count 170
Grant Count 21
R01 Count 13
Funding $2,072,864.37
PubMed Score 803.84
PubTator Score 867.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.200 0.000

Gene RIF (98)

PMID Text
26908325 AACT is downregulated in NSCLC. The GlcNAcylated AACT can effectively differentiate Stage I non-small cell lung cancer from healthy or benign lung disease samples.
26210716 The ACT gene (also named SERPINA3) was mapped on chromosome 14q32.1 We studied the association between Alpha-1 antichymotrypsin (ACT) signal peptide A/T polymorphism polymorphism and risk of primary intracerebral hemorrhage
25170552 Proteome demonstration of alpha-1-acid glycoprotein and alpha-1-antichymotrypsin candidate biomarkers for diagnosis of enterovirus 71 infection
24817931 SERPINA3 promotes endometrial cancer cells growth by regulating G2/M cell cycle checkpoint and apoptosis.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of serpin peptidase inhibitor, clade A, member 3 (SERPINA3) in primary human brain microvascular endothelial cells
23867815 Microarray analysis indicates HIV-1 Tat-induced upregulation of serpin peptidase inhibitor, clade A, member 3 (SERPINA3) in primary human brain microvascular endothelial cells
22869038 This study demonistrated that SERPINA3 is changed in the dorsolateral prefrontal cortex of individuals with schizophrenia
22806587 Prostate specific antigen (PSA) forms complexes with alpha1-antichymotrypsin (ACT) within the prostate, which may explain, at least partially, why the ratio of serum PSA-ACT to total PSA is increased in prostate cancer.
22294107 The common alpha1-antichymotrypsin signal peptide -15A/T polymorphism may not be a major risk factor for Alzheimer disease (AD) but the polymorphism is capable of increasing late onset AD risk. [Meta-analysis]
22272609 ACT-17 variation presents a risk factor for Alzheimer's disease in the worldwide population, especially in the Caucasian population.
More...

AA Sequence

MERMLPLLALGLLAAGFCPAVLCHPNSPLDEENLTQENQDRGTHVDLGLASANVDFAFSLYKQLVLKAPD      1 - 70
KNVIFSPLSISTALAFLSLGAHNTTLTEILKGLKFNLTETSEAEIHQSFQHLLRTLNQSSDELQLSMGNA     71 - 140
MFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAAAKKLINDYVKNGTRGKITDLIKDLDSQTMMVLVNY    141 - 210
IFFKAKWEMPFDPQDTHQSRFYLSKKKWVMVPMMSLHHLTIPYFRDEELSCTVVELKYTGNASALFILPD    211 - 280
QDKMEEVEAMLLPETLKRWRDSLEFREIGELYLPKFSISRDYNLNDILLQLGIEEAFTSKADLSGITGAR    281 - 350
NLAVSQVVHKAVLDVFEEGTEASAATAVKITLLSALVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNP    351 - 420
KQA                                                                       421 - 423
//

Text Mined References (172)

PMID Year Title
26908325 2016 Identification of GlcNAcylated alpha-1-antichymotrypsin as an early biomarker in human non-small-cell lung cancer by quantitative proteomic analysis with two lectins.
26210716 2015 Is Alpha-1 Antichymotrypsin Gene Polymorphism a Risk Factor for Primary Intracerebral Hemorrhage? A Case-Control Study and Meta-Analysis.
25645918 2015 Human neutrophils secrete bioactive paucimannosidic proteins from azurophilic granules into pathogen-infected sputum.
25170552 2015 Proteome demonstration of alpha-1-acid glycoprotein and alpha-1-antichymotrypsin candidate biomarkers for diagnosis of enterovirus 71 infection.
24817931 2014 SERPINA3 promotes endometrial cancer cells growth by regulating G2/M cell cycle checkpoint and apoptosis.
24172014 2013 Update of the human and mouse SERPIN gene superfamily.
23669352 2013 Genome-wide analysis of BMI in adolescents and young adults reveals additional insight into the effects of genetic loci over the life course.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23234360 2013 LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins.
More...