Property Summary

Ligand Count 9
NCBI Gene PubMed Count 221
PubMed Score 9678.88
PubTator Score 4170.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
adult high grade glioma 3801 5.2e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (1)

Disease log2 FC p
adult high grade glioma 1.100 5.2e-04

Protein-protein Interaction (6)

Gene RIF (123)

AA Sequence

MYSNVIGTVTSGKRKVYLLSLLLIGFWDCVTCHGSPVDICTAKPRDIPMNPMCIYRSPEKKATEDEGSEQ      1 - 70
KIPEATNRRVWELSKANSRFATTFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVFKF     71 - 140
DTISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQDISELVYGAKLQPLDFKEN    141 - 210
AEQSRAAINKWVSNKTEGRITDVIPSEAINELTVLVLVNTIYFKGLWKSKFSPENTRKELFYKADGESCS    211 - 280
ASMMYQEGKFRYRRVAEGTQVLELPFKGDDITMVLILPKPEKSLAKVEKELTPEVLQEWLDELEEMMLVV    281 - 350
HMPRFRIEDGFSLKEQLQDMGLVDLFSPEKSKLPGIVAEGRDDLYVSDAFHKAFLEVNEEGSEAAASTAV    351 - 420
VIAGRSLNPNRVTFKANRPFLVFIREVPLNTIIFMGRVANPCVK                              421 - 464
//

Text Mined References (230)

PMID Year Title