Property Summary

NCBI Gene PubMed Count 182
Grant Count 48
R01 Count 34
Funding $4,405,222.15
PubMed Score 508.39
PubTator Score 1251.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Gene RIF (203)

PMID Text
26743468 Approx 25% of discontinuously involved prostate biopsy cores showed tumor foci with discordant ERG/SPINK1 status, consistent with multiclonal disease.
26658045 Letter/Case Report: high penetrance of the PRSS1 A16V mutation caused by SPINK1 N34S and CFTR TG11-5T co-mutations associated with pancreatitis.
26632706 Patients with SPINK1 N34S mutations were more likely to develop a Dilated duct, Calcifications, and Diabetes as Long-term Outcome of Endoscopic Treatments in Idiopathic Chronic Pancreatitis.
26437224 expression represents an independent prognostic factor for poor survival in ovarian carcinoma patients
26376395 no mutation associated with pancreatitis
26348468 Identify SPINK1 promoter variants exhibiting significant functional defects that should be considered potential risk factors for chronic pancreatitis.
26172920 neither ERG nor SPINK1 appear to be useful biomarkers for prognostication of early stage prostate cancer
26124326 SPINK1 promoter variants are likely to be associated with the risk of BPH.
26100556 Mutation p.N34S in SPINK1 may predispose patients to acute pancreatitis, especially in those abusing alcohol, and may promote a more severe course of the disease.
26054682 Over-expression of FOXP1 and SPINK1 may participate in the carcinogenesis of hepatitis B virus related cirrhosis.
More...

AA Sequence

MKVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTS      1 - 70
ILIQKSGPC                                                                  71 - 79
//

Text Mined References (183)

PMID Year Title
26743468 2016 Clonal evaluation of prostate cancer foci in biopsies with discontinuous tumor involvement by dual ERG/SPINK1 immunohistochemistry.
26658045 2016 High Penetrance of the PRSS1 A16V Mutation in a Kindred With SPINK1 N34S and CFTR TG11-5T Co-mutations.
26632706 2015 Serine Protease Inhibitor Kazal Type 1 (SPINK1) c.194+2T > C Mutation May Predict Long-term Outcome of Endoscopic Treatments in Idiopathic Chronic Pancreatitis.
26437224 2015 Serine protease inhibitor Kazal type 1 (SPINK1) drives proliferation and anoikis resistance in a subset of ovarian cancers.
26376395 2015 Hereditary Pancreatitis Associated With the N29T Mutation of the PRSS1 Gene in a Brazilian Family: A Case-Control Study.
26348468 2016 SPINK1 Promoter Variants in Chronic Pancreatitis.
26172920 2015 Evaluation of ERG and SPINK1 by Immunohistochemical Staining and Clinicopathological Outcomes in a Multi-Institutional Radical Prostatectomy Cohort of 1067 Patients.
26124326 2015 SPINK1 Promoter Variants Are Associated with Prostate Cancer Predisposing Alterations in Benign Prostatic Hyperplasia Patients.
26100556 2015 Genetic mutations in SPINK1, CFTR, CTRC genes in acute pancreatitis.
26054682 2015 FOXP1 and SPINK1 reflect the risk of cirrhosis progression to HCC with HBV infection.
More...