Property Summary

NCBI Gene PubMed Count 98
Grant Count 29
R01 Count 7
Funding $3,730,286.24
PubMed Score 77.34
PubTator Score 89.30

Knowledge Summary

Patent

No data available

Expression

Gene RIF (71)

PMID Text
26643049 ELF-1 binds an important duplicated GGAA cis-acting element at the OAS1 promoter and in cooperation with RB1 and SP1 recruitment contributes to regulation in response to IFN stimulation.
26516113 Knockdown of OAS1 rescues Lipopolysaccharide-induced cell death and thus may be a promising therapeutic strategy for orthopedic diseases.
26505957 The multivariate analysis showed that the OAS1 GA and AA genotypes were independent factors associated with liver fibrosis progression (p = 0.009, odds ratio [OR] 3.467, 95% confidence interval [CI] 1.273-7.584).
26412166 No association is identified between OAS1 SNP and susceptibility to spontaneous preterm birth (SPTB) and preterm premature rupture of membranes (PPROM).
26398832 Preliminary study suggests that OAS gene cluster and CD209 gene polymorphisms influence the risk of developing clinical symptoms in Chikungunya virus-infected patients.
26063222 While both OAS1-p42 and p46 showed antiviral activity against Dengue irus 2, only OAS1-p42 presented anti-Dengue irus 1 activity.
25980612 Production of infectious triple deletion vpr/vpu/nef HIV-1 mutant is suppressed, indicating that Nef may antagonize restriction activity of OAS1 against production of infectious wild-type HIV-1
25980612 Production of infectious triple deletion vpr/vpu/nef HIV-1 mutant is suppressed, indicating that Nef may antagonize restriction activity of OAS1 against production of infectious wild-type HIV-1
25980612 Production of infectious triple deletion vpr/vpu/nef HIV-1 mutant is suppressed, indicating that Nef may antagonize restriction activity of OAS1 against production of infectious wild-type HIV-1
25550087 along with TLR3, functions as a virus recognition receptor on mast cells activating the latent form of RNase L, leading to viral RNA degradation
More...

AA Sequence

MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTL      1 - 70
RGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQ     71 - 140
LGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIR    141 - 210
LVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKN    211 - 280
PIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLAESN    281 - 350
SADDETDDPRRYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWTCTIL                        351 - 400
//

Text Mined References (99)

PMID Year Title
26643049 2015 The hematopoietic regulator, ELF-1, enhances the transcriptional response to Interferon-? of the OAS1 anti-viral gene.
26516113 2015 Low expression of microRNA-21 contributes to LPS-induced osteoblast cell apoptosis through up-regulation of OAS1.
26505957 2015 Impact of OAS1 Exon 7 rs10774671 Genetic Variation on Liver Fibrosis Progression in Egyptian HCV Genotype 4 Patients.
26412166 2015 [A case-control study on association between OAS1 polymorphism and susceptibility to spontaneous preterm birth and preterm premature rupture of membranes].
26398832 2016 Association of Oligoadenylate Synthetase Gene Cluster and DC-SIGN (CD209) Gene Polymorphisms with Clinical Symptoms in Chikungunya Virus Infection.
26063222 2015 High Anti-Dengue Virus Activity of the OAS Gene Family Is Associated With Increased Severity of Dengue.
25550087 2015 Roles of retinoic acid-inducible gene-I-like receptors (RLRs), Toll-like receptor (TLR) 3 and 2'-5' oligoadenylate synthetase as viral recognition receptors on human mast cells in response to viral infection.
25477390 2015 A novel RNA molecular signature for activation of 2'-5' oligoadenylate synthetase-1.
25416956 2014 A proteome-scale map of the human interactome network.
25205466 2014 Mitochondrial localization of the OAS1 p46 isoform associated with a common single nucleotide polymorphism.
More...