Property Summary

NCBI Gene PubMed Count 103
PubMed Score 92.30
PubTator Score 89.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Diabetes Mellitus, Type 1 43 0.0 0.0
Influenza, Human 51 0.0 0.0
Virus Diseases 2 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 3.0
Disease Target Count Z-score Confidence
Type 1 diabetes mellitus 109 0.0 5.0
Disease Target Count
IDDM 5

Expression

  Differential Expression (27)

Disease log2 FC p
adult high grade glioma 1.700 2.2e-04
Astrocytoma, Pilocytic 1.500 5.4e-05
Atopic dermatitis 1.500 1.7e-03
Breast cancer 1.400 1.1e-04
breast carcinoma 1.300 8.8e-05
chronic rhinosinusitis 1.066 5.0e-02
cutaneous lupus erythematosus 3.100 1.7e-05
cystic fibrosis 1.474 1.6e-02
glioblastoma 1.300 2.5e-04
hepatocellular carcinoma 1.200 5.8e-03
intraductal papillary-mucinous carcinoma... 1.900 7.1e-03
intraductal papillary-mucinous neoplasm ... 3.100 6.8e-04
invasive ductal carcinoma 1.023 1.1e-02
juvenile dermatomyositis 2.855 1.7e-18
lung adenocarcinoma 1.301 1.9e-03
lung cancer -1.500 1.1e-03
lung carcinoma -1.100 1.1e-07
malignant mesothelioma 5.900 6.2e-09
Multiple Sclerosis 2.000 1.7e-02
ovarian cancer 1.200 3.4e-02
pancreatic cancer 1.600 2.4e-04
posterior fossa group B ependymoma 1.100 9.5e-03
primary Sjogren syndrome 1.300 3.4e-02
psoriasis 2.000 1.2e-07
subependymal giant cell astrocytoma 1.608 3.6e-02
Systemic lupus erythematosus 1.400 1.1e-04
tuberculosis 2.300 3.6e-04

Gene RIF (73)

AA Sequence

MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTL      1 - 70
RGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQ     71 - 140
LGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIR    141 - 210
LVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKN    211 - 280
PIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLAESN    281 - 350
SADDETDDPRRYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWTCTIL                        351 - 400
//

Text Mined References (105)

PMID Year Title