Property Summary

Ligand Count 2,645
NCBI Gene PubMed Count 73
PubMed Score 2053.50
PubTator Score 4036.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
active ulcerative colitis -2.361 4.1e-02
acute myeloid leukemia -2.200 2.9e-02
colon cancer -2.800 2.1e-03
group 3 medulloblastoma -1.300 3.2e-03
lung cancer -1.500 5.1e-03
mucosa-associated lymphoid tissue lympho... 2.692 1.3e-02
osteosarcoma -5.929 7.7e-05
sarcoidosis 1.300 2.8e-02
tuberculosis 1.900 1.9e-02

Synonym

Accession P00915
Symbols CAB
CA-I
Car1
HEL-S-11

Gene

CA1

PDB

1AZM   1BZM   1CRM   1CZM   1HCB   1HUG   1HUH   1J9W   1JV0   2CAB   2FOY   2FW4   2IT4   2NMX   2NN1   2NN7   3LXE   3W6H   3W6I   4WR7   4WUP   4WUQ   5E2M   5GMM  

  Ortholog (1)

Species Source Disease
Chimp OMA Inparanoid

Gene RIF (27)

AA Sequence

MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVN      1 - 70
FEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKAD     71 - 140
GLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTW    141 - 210
IICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF                       211 - 261
//

Text Mined References (90)

PMID Year Title