Property Summary

NCBI Gene PubMed Count 65
Grant Count 252
R01 Count 101
Funding $48,729,637.89
PubMed Score 1961.98
PubTator Score 4036.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -5.929 0.000
tuberculosis 1.900 0.019
colon cancer -6.500 0.000
lung cancer -1.900 0.000
ulcerative colitis -4.100 0.000
group 3 medulloblastoma -1.300 0.003
mucosa-associated lymphoid tissue lympho... 2.692 0.013
acute myeloid leukemia -2.200 0.029
sarcoidosis 1.300 0.028

Synonym

Accession P00915
Symbols CAB
CA-I
Car1
HEL-S-11

Gene

CA1

PANTHER Protein Class (2)

PDB

1AZM   1BZM   1CRM   1CZM   1HCB   1HUG   1HUH   1J9W   1JV0   2CAB   2FOY   2FW4   2IT4   2NMX   2NN1   2NN7   3LXE   3W6H   3W6I   4WR7   4WUP   4WUQ  

Gene RIF (20)

PMID Text
26475450 We report on the competitive zinc metalation of apo-carbonic anhydrase [CA; metal-free CA (apo-CA)] in the presence of apo-metallothionein 1A domain fragments to identify domain specific determinants of zinc binding and zinc donation
26459317 CA1 is a potential oncogene and that it contributes to abnormal cell calcification, apoptosis and migration in breast cancer.
25165709 Structure-activity relationships study showed that indolylchalcone derivatives have higher inhibitory activities than pyrido[2,3-d]pyrimidine derivatives on hCA I and hCA II.
24670789 Myocardial carbonic anhydrase 1/2 activation is significantly elevated in diabetic ischemic cardiomyopathy.
23557951 may be involved in the pathogenesis of Abdominal aortic aneurysm
22996014 The new prognostic biomarkers GRP78, Fructose-bisphosphate Aldolase A (ALDOA), Carbonic Anhydrase I (CA1) and Peptidyl-prolyl cis-trans isomerase A or Cyclophilin A (PPIA)) provided good survival prediction for TNM stage I-IV patients.
22838845 The gene encoding CA1 is susceptible to ankylosing spondylitis and plays a role in the process of bone formation.
22619369 carbonic anhydrase I, phosphoglycerate kinase 1 and apolipoprotein A-I appeared to be the most significant variations of proteins in patients with osteopenia and osteoarthritis
22416960 A significant correlation was found between positive carbonic anhydrase I staining and oral squamous cell carcinoma for more advanced clinical stage and larger tumor size, but not for positive lymph node metastasis, distal metastasis, and recurrence.
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
More...

AA Sequence

MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVN      1 - 70
FEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKAD     71 - 140
GLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTW    141 - 210
IICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF                       211 - 261
//

Text Mined References (82)

PMID Year Title
26475450 2015 Putting the pieces into place: Properties of intact zinc metallothionein 1A determined from interaction of its isolated domains with carbonic anhydrase.
26459317 2015 CA1 contributes to microcalcification and tumourigenesis in breast cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25165709 2014 Synthesis and in vitro inhibition effect of new pyrido[2,3-d]pyrimidine derivatives on erythrocyte carbonic anhydrase I and II.
24878360 2014 Carbonic anhydrase inhibitors: Synthesis, molecular docking, cytotoxic and inhibition of the human carbonic anhydrase isoforms I, II, IX, XII with novel benzenesulfonamides incorporating pyrrole, pyrrolopyrimidine and fused pyrrolopyrimidine moieties.
24670789 2014 Carbonic anhydrase activation is associated with worsened pathological remodeling in human ischemic diabetic cardiomyopathy.
24289818 2014 Antipsychotic agents screened as human carbonic anhydrase I and II inhibitors.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23993330 2013 Effect of incorporating a thiophene tail in the scaffold of acetazolamide on the inhibition of human carbonic anhydrase isoforms I, II, IX and XII.
23892086 2013 Overlap of epitopes recognized by anti-carbonic anhydrase I IgG in patients with malignancy-related aplastic anemia-like syndrome and in patients with aplastic anemia.
More...