Property Summary

NCBI Gene PubMed Count 1
PubMed Score 542.08
PubTator Score 292.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

Gene RIF (60)

AA Sequence

MNENLFASFIAPTILGLPAAVLIILFPPLLIPTSKYLINNRLITTQQWLIKLTSKQMMTMHNTKGRTWSL      1 - 70
MLVSLIIFIATTNLLGLLPHSFTPTTQLSMNLAMAIPLWAGTVIMGFRSKIKNALAHFLPQGTPTPLIPM     71 - 140
LVIIETISLLIQPMALAVRLTANITAGHLLMHLIGSATLAMSTINLPSTLIIFTILILLTILEIAVALIQ    141 - 210
AYVFTLLVSLYLHDNT                                                          211 - 226
//

Text Mined References (32)

PMID Year Title