Property Summary

Ligand Count 39
NCBI Gene PubMed Count 211
PubMed Score 753.11
PubTator Score 2805.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count
Hairy Cell Leukemia 5
Disease Target Count Z-score Confidence
Adenosine deaminase deficiency 3 0.0 5.0
Disease Target Count Z-score Confidence
Congenital hemolytic anemia 32 0.0 4.0

Expression

  Differential Expression (13)

Disease log2 FC p
tuberculosis -1.400 5.1e-04
active Crohn's disease 1.047 4.8e-02
cystic fibrosis -1.092 7.3e-05
ependymoma -1.200 2.8e-02
gastric carcinoma -1.900 1.1e-02
group 4 medulloblastoma -1.300 5.4e-04
inflammatory breast cancer 1.100 1.0e-02
interstitial cystitis 2.100 2.5e-04
intraductal papillary-mucinous carcinoma... -1.100 1.8e-03
medulloblastoma, large-cell -1.200 7.5e-05
nasopharyngeal carcinoma 1.400 3.8e-03
ovarian cancer 1.200 4.0e-04
ulcerative colitis 1.700 3.9e-05

Protein-protein Interaction (2)

Gene RIF (171)

AA Sequence

MAQTPAFDKPKVELHVHLDGSIKPETILYYGRRRGIALPANTAEGLLNVIGMDKPLTLPDFLAKFDYYMP      1 - 70
AIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVALVGQGLQEG     71 - 140
ERDFGVKARSILCCMRHQPNWSPKVVELCKKYQQQTVVAIDLAGDETIPGSSLLPGHVQAYQEAVKSGIH    141 - 210
RTVHAGEVGSAEVVKEAVDILKTERLGHGYHTLEDQALYNRLRQENMHFEICPWSSYLTGAWKPDTEHAV    211 - 280
IRLKNDQANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPEDEKRELLDLLYKA    281 - 350
YGMPPSASAGQNL                                                             351 - 363
//

Text Mined References (219)

PMID Year Title