Property Summary

NCBI Gene PubMed Count 198
Grant Count 376
R01 Count 208
Funding $65,550,147.7
PubMed Score 678.11
PubTator Score 2805.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Synonym

Accession P00813 Q53F92 Q6LA59
Symbols

Gene

ADA

PANTHER Protein Class (2)

PDB

1M7M   3IAR  

Gene RIF (158)

PMID Text
26707067 We conclude that pleural ADA activity could be integrated in the diagnostic procedures of pTB in low to medium tuberculosis prevalence settings.
26376800 variable mutations are identified as a cause of immunodeficiency in a single Italian center
26329539 ADA and ADK are involved in glioma progression; increased ADA and ADK levels in peritumoral tissues may be associated with epilepsy in glioma patients.
26310829 In autologous cocultures of T cells with HIV-1-pulsed dendritic cells, adenosine deaminase decreased HIV-1-induced CD4(+)CD25(hi) FOXP3(+) cells and enhanced the HIV-1-specific CD4(+) responder T cells.
26261621 Pleural ADA activity is an accurate test for the diagnosis of tuberculous pleural effusions.
26216523 ADA6, PTPN22 and ACP1 are involved in immune reactions: since endometriosis has an autoimmune component.
26166670 activity of ADA isoenzymes and distribution of ADA1 G22 A genotypes were different among fertile and infertile men and more likely the GA genotype, which had lower ADA1 activity and was higher in fertile men is a protective factor against infertility.
25963491 Multiplex PCR and thoracoscopy are useful investigations in the diagnostic work-up of pleural effusions complicating CKD while the sensitivity and/or specificity of ADA and 65 kDa gene PCR is poor
25764155 Serum ADA levels were increased in secondary hemophagocytic lymphohistiocytosis suggesting a partial role of activated T-cell response in the disease pathophysiology.
25647479 the diagnostic utility of pfADA in a low mTB incidence area
More...

AA Sequence

MAQTPAFDKPKVELHVHLDGSIKPETILYYGRRRGIALPANTAEGLLNVIGMDKPLTLPDFLAKFDYYMP      1 - 70
AIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVALVGQGLQEG     71 - 140
ERDFGVKARSILCCMRHQPNWSPKVVELCKKYQQQTVVAIDLAGDETIPGSSLLPGHVQAYQEAVKSGIH    141 - 210
RTVHAGEVGSAEVVKEAVDILKTERLGHGYHTLEDQALYNRLRQENMHFEICPWSSYLTGAWKPDTEHAV    211 - 280
IRLKNDQANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPEDEKRELLDLLYKA    281 - 350
YGMPPSASAGQNL                                                             351 - 363
//

Text Mined References (206)

PMID Year Title
26707067 2016 Adenosine deaminase is a useful biomarker to diagnose pleural tuberculosis in low to medium prevalence settings.
26376800 2015 Diagnosis, Treatment and Long-Term Follow Up of Patients with ADA Deficiency: a Single-Center Experience.
26329539 2015 Adenosine deaminase and adenosine kinase expression in human glioma and their correlation with glioma?associated epilepsy.
26310829 2016 Adenosine deaminase regulates Treg expression in autologous T cell-dendritic cell cocultures from patients infected with HIV-1.
26261621 2015 Combined evaluation of adenosine deaminase level and histopathological findings from pleural biopsy with Cope's needle for the diagnosis of tuberculous pleurisy.
26216523 2016 The effect of ACP1, ADA6 and PTPN22 genetic polymorphisms on the association between p53 codon 72 polymorphism and endometriosis.
26166670 2015 The Role of G22 A Adenosine Deaminase 1 Gene Polymorphism and the Activities of ADA Isoenzymes in Fertile and Infertile Men.
25963491 2015 Utility of adenosine deaminase (ADA), PCR & thoracoscopy in differentiating tuberculous & non-tuberculous pleural effusion complicating chronic kidney disease.
25764155 2015 Elevated serum adenosine deaminase levels in secondary hemophagocytic lymphohistiocytosis.
25647479 2015 Pleural fluid adenosine deaminase (pfADA) in the diagnosis of tuberculous effusions in a low incidence population.
More...