Property Summary

NCBI Gene PubMed Count 162
Grant Count 120
R01 Count 86
Funding $17,209,261.12
PubMed Score 695.66
PubTator Score 324.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer -1.300 0.000
psoriasis 1.900 0.000

Synonym

Accession P00751 B0QZQ6 O15006 Q29944 Q53F89 Q5JP67 Q5ST50 Q96HX6 Q9BTF5 Q9BX92
Symbols BF
FB
BFD
GBG
CFAB
CFBD
PBF2
AHUS4
FBI12
H2-Bf
ARMD14

Gene

CFB

PDB

2WIN   2XWB   2XWJ   1DLE   1Q0P   1RRK   1RS0   1RTK   2OK5   3HRZ   3HS0  

Gene RIF (120)

PMID Text
26908325 CFB is downregulated in non-small cell lung cancer patients compared to those with benign lung disease or no lung disease.
26660535 P serum level expression could be a reliable clinical biomarker to identify patients with underlying surface alternative pathway C5 convertase dysregulation.
26510395 The Relationship of Longitudinal Levels of Complement Bb During Pregnancy with Preeclampsia
25802187 individuals with the chronic hepatitis B (CHB) risk genotype CC of rs12614 had significantly lower CFB concentrations than those carrying one or two rs12614 T alleles (CT or TT carriers) both in normal populations and CHB patients
25758434 complement factor B has an important role in the etiology of familial C3 glomerulonephritis
25604034 These results suggest that a maternal immune response through complement fB might play a role in the development of preeclampsia, particularly in African-American patients.
25532781 A mutation in complement factor B was associated with a case of C3 glomerulonephritis.
25057901 Complement factor B is a novel biomarker candidate for pancreatic ductal adenocarcinoma.
24965207 The C2 and CFB gene variants were shown to be associated with polypoidal CNV. Typical PCV was not associated with variants in these genes.
24906628 mutation results in atypical hemolytic uremic syndrome
More...

AA Sequence

MGSNLSPQLCLMPFILGLLSGGVTTTPWSLARPQGSCSLEGVEIKGGSFRLLQEGQALEYVCPSGFYPYP      1 - 70
VQTRTCRSTGSWSTLKTQDQKTVRKAECRAIHCPRPHDFENGEYWPRSPYYNVSDEISFHCYDGYTLRGS     71 - 140
ANRTCQVNGRWSGQTAICDNGAGYCSNPGIPIGTRKVGSQYRLEDSVTYHCSRGLTLRGSQRRTCQEGGS    141 - 210
WSGTEPSCQDSFMYDTPQEVAEAFLSSLTETIEGVDAEDGHGPGEQQKRKIVLDPSGSMNIYLVLDGSDS    211 - 280
IGASNFTGAKKCLVNLIEKVASYGVKPRYGLVTYATYPKIWVKVSEADSSNADWVTKQLNEINYEDHKLK    281 - 350
SGTNTKKALQAVYSMMSWPDDVPPEGWNRTRHVIILMTDGLHNMGGDPITVIDEIRDLLYIGKDRKNPRE    351 - 420
DYLDVYVFGVGPLVNQVNINALASKKDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGMVWEHRKGTDY    421 - 490
HKQPWQAKISVIRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYN    491 - 560
INGKKEAGIPEFYDYDVALIKLKNKLKYGQTIRPICLPCTEGTTRALRLPPTTTCQQQKEELLPAQDIKA    561 - 630
LFVSEEEKKLTRKEVYIKNGDKKGSCERDAQYAPGYDKVKDISEVVTPRFLCTGGVSPYADPNTCRGDSG    631 - 700
GPLIVHKRSRFIQVGVISWGVVDVCKNQKRQKQVPAHARDFHINLFQVLPWLKEKLQDEDLGFL          701 - 764
//

Text Mined References (164)

PMID Year Title
26908325 2016 Identification of GlcNAcylated alpha-1-antichymotrypsin as an early biomarker in human non-small-cell lung cancer by quantitative proteomic analysis with two lectins.
26660535 2016 Serum properdin consumption as a biomarker of C5 convertase dysregulation in C3 glomerulopathy.
26510395 2016 The Relationship of Longitudinal Levels of Complement Bb During Pregnancy with Preeclampsia.
25802187 2015 Genetic variants in five novel loci including CFB and CD40 predispose to chronic hepatitis B.
25758434 2015 Familial C3 glomerulonephritis associated with mutations in the gene for complement factor B.
25604034 2015 Complement factor B activation in patients with preeclampsia.
25532781 2015 C3 glomerulonephritis associated with complement factor B mutation.
25057901 2014 Identification of human complement factor B as a novel biomarker candidate for pancreatic ductal adenocarcinoma.
24965207 2014 Associations of complement factor B and complement component 2 genotypes with subtypes of polypoidal choroidal vasculopathy.
24906628 2014 A complement factor B mutation in a large kindred with atypical hemolytic uremic syndrome.
More...