Property Summary

NCBI Gene PubMed Count 329
PubMed Score 5679.21
PubTator Score 3070.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
psoriasis 6685 4.74694457914106E-60
periodontitis 269 8.18325564452982E-31
pilocytic astrocytoma 3086 1.07075120761631E-12
breast carcinoma 1614 6.70097850238082E-12
malignant mesothelioma 3163 1.52909223765022E-9
cystic fibrosis 1670 2.56834605287809E-7
lung carcinoma 2844 3.64089203001055E-7
adrenocortical carcinoma 1427 1.13166484293935E-6
Breast cancer 3099 9.98200429390128E-6
pediatric high grade glioma 2712 3.17936147873014E-5
ulcerative colitis 2087 1.82518500386404E-4
primary pancreatic ductal adenocarcinoma 1271 1.86681509985688E-4
pancreatic cancer 2300 4.08973323534379E-4
group 4 medulloblastoma 1875 4.10085280230798E-4
ovarian cancer 8492 0.00157968472475653
fibroadenoma 557 0.00227514105724786
chronic rhinosinusitis 512 0.00853973032354001
oligodendroglioma 2849 0.0119956712072306
ependymoma 2514 0.0185269376506593
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0251830003770055
Barrett's esophagus 185 0.026749997564992
colon cancer 1475 0.0322925495120691
glioblastoma 5572 0.0327409493345321
Atopic dermatitis 944 0.0418041005137239
Disease Target Count
Intracranial Hemorrhages 4
THPH9 1

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma -4.500 0.000
ependymoma -1.100 0.019
oligodendroglioma -1.200 0.012
Barrett's esophagus 1.700 0.027
psoriasis 2.200 0.000
glioblastoma 2.900 0.033
cystic fibrosis 2.292 0.000
periodontitis 1.400 0.000
Atopic dermatitis 1.200 0.042
adrenocortical carcinoma -2.846 0.000
primary pancreatic ductal adenocarcinoma 4.075 0.000
intraductal papillary-mucinous adenoma (... -1.400 0.025
colon cancer -1.400 0.032
pancreatic cancer 4.000 0.000
fibroadenoma 2.100 0.002
pediatric high grade glioma 2.200 0.000
group 4 medulloblastoma -1.200 0.000
pilocytic astrocytoma 3.200 0.000
Breast cancer -2.400 0.000
lung carcinoma 1.100 0.000
breast carcinoma -1.400 0.000
ulcerative colitis 1.600 0.000
ovarian cancer 2.200 0.002
chronic rhinosinusitis 1.832 0.009

Synonym

Gene

PDB

1A5H   1BDA   1PK2   1PML   1RTF   1TPG   1TPK   1TPM   1TPN   5BRR  

  Ortholog (12)

 CSPA Cell Line (3)

Gene RIF (264)

PMID Text
26942412 tPA has a role in progression of periventricular white matter hyperintensities
26881424 These data indicate that oxygen-glucose deprivation-triggered Cav-1 S-nitrosylation interacts with tPA-induced ERK activation to augment MMP2 and 9 secretion and subsequent extracellular matrix degradation.
26704613 Tissue plasminogen activator (tPA) may be a general factor in the immunological response to viruses.
26548921 This study examines the complexes of PAI-1 with tissue-type and urokinase-type plasminogen activator and vitronectin revealed by changes in the conformation and dynamics of the reactive center loop.
26469972 tPA-dependent activation of EGFRs leads to downregulation of NMDAR signaling and to subsequent neurotrophic effects.
26339655 Among patients with elevated concentrations of the CA 15-3, CEA, and TPA concordance could be observed between serial changes of the hypermethylated RASSF1A gene and the protein markers
26324706 report the crystal structure of the tPA.PAI-1 Michaelis complex, which shows significant differences from the structure of its urokinase-type plasminogen activator analogue, the uPA.PAI-1 Michaelis complex
26002716 Patients in the acute stage of ischemic stroke had significantly increased levels of t-PA activity and beta-TG content, but PAI-1 activity was significantly decreased
25970741 Data suggest that baseline levels of adiponectin, C-reactive protein, TPA, and fibrinogen or changes in these levels do not explain increased risk of diabetes type 2 in overweight women with glucose intolerance and histories of gestational diabetes.
25855589 Tissue-type plasminogen activator-binding RNA aptamers inhibiting low-density lipoprotein receptor family-mediated internalization may improve safety of thrombolytic therapy.
More...

AA Sequence

MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCW      1 - 70
CNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCEIDTRATCYEDQGISYRGTWS     71 - 140
TAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHNYCRNPDRDSKPWCYVFKAGKYSSEFCSTPACSE    141 - 210
GNSDCYFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHV    211 - 280
LKNRRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSC    281 - 350
WILSAAHCFQERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCA    351 - 420
QESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQHLLNRTVTDNM    421 - 490
LCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNM    491 - 560
RP                                                                        561 - 562
//

Text Mined References (331)

PMID Year Title
26942412 2016 Plasma tPA-Activity and Progression of Cerebral White Matter Hyperintensities in Lacunar Stroke Patients.
26881424 2016 Release of Matrix Metalloproteinases-2 and 9 by S-Nitrosylated Caveolin-1 Contributes to Degradation of Extracellular Matrix in tPA-Treated Hypoxic Endothelial Cells.
26704613 2016 Interferons Induce STAT1-Dependent Expression of Tissue Plasminogen Activator, a Pathogenicity Factor in Puumala Hantavirus Disease.
26548921 2016 Distinct encounter complexes of PAI-1 with plasminogen activators and vitronectin revealed by changes in the conformation and dynamics of the reactive center loop.
26528141 2015 Impacts of tissue-type plasminogen activator (tPA) on neuronal survival.
26469972 2015 Conformations of tissue plasminogen activator (tPA) orchestrate neuronal survival by a crosstalk between EGFR and NMDAR.
26339655 2015 Concordance of Hypermethylated DNA and the Tumor Markers CA 15-3, CEA, and TPA in Serum during Monitoring of Patients with Advanced Breast Cancer.
26324706 2015 Crystal Structure of the Michaelis Complex between Tissue-type Plasminogen Activator and Plasminogen Activators Inhibitor-1.
26002716 2015 Dynamic changes in plasma tissue plasminogen activator, plasminogen activator inhibitor-1 and beta-thromboglobulin content in ischemic stroke.
25970741 2016 Adiponectin, C-reactive protein, fibrinogen and tissue plasminogen activator antigen levels among glucose-intolerant women with and without histories of gestational diabetes.
More...