Property Summary

NCBI Gene PubMed Count 329
Grant Count 809
R01 Count 402
Funding $142,260,823.37
PubMed Score 5679.21
PubTator Score 3070.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (86)

Disease Z-score Confidence
Cerebrovascular disease 231 7.246 3.6
Myocardial Infarction 126 6.891 3.4
Pulmonary Embolism 45 6.174 3.1
Coronary thrombosis 4 5.348 2.7
Heart disease 279 4.588 2.3
Thrombophilia 36 4.534 2.3
Intermediate coronary syndrome 12 4.449 2.2
Atherosclerosis 275 4.184 2.1
Hypertension 287 4.171 2.1
post-thrombotic syndrome 5 4.068 2.0
Cancer 2,346 3.952 2.0
diabetes mellitus 1,663 3.802 1.9
Peripheral vascular disease 90 3.658 1.8
Aphasia 22 3.503 1.8
Brain Ischemia 87 3.484 1.7
Angioedema 36 3.376 1.7
Kidney disease 396 3.337 1.7
Acidosis, Lactic 4
Airway Obstruction 3
Amphetamine-Related Disorders 74
Anoxia 33
Arterial Occlusive Diseases 3
Atopic dermatitis 944
Back Pain 1
Bacteremia 2
Barrett's esophagus 183
Brain infarction 17
Breast cancer 3,094
Cardiac tamponade 4
Cerebral Hemorrhage 27
Cerebral Infarction 9
Cerebrovascular accident 44
Cholesterol embolism 5
Compression of spinal cord 3
Dermatitis, Allergic Contact 66
Drug-Induced Liver Injury 118
Embolism 2
Embolism and Thrombosis 1
Heart failure 80
Hematoma, Epidural, Spinal 1
Hematoma, Subdural 1
Hemorrhage 18
Hyperfibrinolysis Induced Hemorrhage 2
Hypertensive disease 193
Hypotension 53
Infarction, Middle Cerebral Artery 25
Intracranial Embolism and Thrombosis 2
Intracranial Hemorrhages 4
Intracranial Thrombosis 3
Low Back Pain 2
Meningoencephalitis 13
Nerve Degeneration 73
Neurotoxicity Syndromes 26
Paresis 2
Pericardial effusion 10
Postsurgical Hemorrhage 2
Reperfusion Injury 84
Respiratory Insufficiency 11
Shock, Cardiogenic 3
Thromboembolism 12
Thrombophilia, Familial, Due To Decrease... 1 
Thrombosis 42
Vasospasm, Intracranial 5
Venous Thromboembolism 34
Venous Thrombosis 21
adrenocortical carcinoma 1,427
breast carcinoma 1,614
chronic rhinosinusitis 512
colon cancer 1,475
cystic fibrosis 1,665
ependymoma 2,514
fibroadenoma 557
glioblastoma 5,572
group 4 medulloblastoma 1,875
intraductal papillary-mucinous adenoma (... 2,956 
lung carcinoma 2,844
malignant mesothelioma 3,162
oligodendroglioma 2,849
ovarian cancer 8,484
pancreatic cancer 2,300
pediatric high grade glioma 2,712
periodontitis 269
pilocytic astrocytoma 3,086
primary pancreatic ductal adenocarcinoma 1,271
psoriasis 6,685
ulcerative colitis 2,087

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma -4.500 0.000
ependymoma -1.100 0.019
oligodendroglioma -1.200 0.012
Barrett's esophagus 1.700 0.027
psoriasis 2.200 0.000
glioblastoma 2.900 0.033
cystic fibrosis 2.292 0.000
periodontitis 1.400 0.000
Atopic dermatitis 1.200 0.042
adrenocortical carcinoma -2.846 0.000
primary pancreatic ductal adenocarcinoma 4.075 0.000
intraductal papillary-mucinous adenoma (... -1.400 0.025
colon cancer -1.400 0.032
pancreatic cancer 4.000 0.000
fibroadenoma 2.100 0.002
pediatric high grade glioma 2.200 0.000
group 4 medulloblastoma -1.200 0.000
pilocytic astrocytoma 3.200 0.000
Breast cancer -2.400 0.000
lung carcinoma 1.100 0.000
breast carcinoma -1.400 0.000
ulcerative colitis 1.600 0.000
ovarian cancer 2.200 0.002
chronic rhinosinusitis 1.832 0.009

Synonym

Gene

PDB

1A5H   1BDA   1PK2   1PML   1RTF   1TPG   1TPK   1TPM   1TPN   5BRR  

Gene RIF (264)

PMID Text
26942412 tPA has a role in progression of periventricular white matter hyperintensities
26881424 These data indicate that oxygen-glucose deprivation-triggered Cav-1 S-nitrosylation interacts with tPA-induced ERK activation to augment MMP2 and 9 secretion and subsequent extracellular matrix degradation.
26704613 Tissue plasminogen activator (tPA) may be a general factor in the immunological response to viruses.
26548921 This study examines the complexes of PAI-1 with tissue-type and urokinase-type plasminogen activator and vitronectin revealed by changes in the conformation and dynamics of the reactive center loop.
26469972 tPA-dependent activation of EGFRs leads to downregulation of NMDAR signaling and to subsequent neurotrophic effects.
26339655 Among patients with elevated concentrations of the CA 15-3, CEA, and TPA concordance could be observed between serial changes of the hypermethylated RASSF1A gene and the protein markers
26324706 report the crystal structure of the tPA.PAI-1 Michaelis complex, which shows significant differences from the structure of its urokinase-type plasminogen activator analogue, the uPA.PAI-1 Michaelis complex
26002716 Patients in the acute stage of ischemic stroke had significantly increased levels of t-PA activity and beta-TG content, but PAI-1 activity was significantly decreased
25970741 Data suggest that baseline levels of adiponectin, C-reactive protein, TPA, and fibrinogen or changes in these levels do not explain increased risk of diabetes type 2 in overweight women with glucose intolerance and histories of gestational diabetes.
25855589 Tissue-type plasminogen activator-binding RNA aptamers inhibiting low-density lipoprotein receptor family-mediated internalization may improve safety of thrombolytic therapy.
More...

AA Sequence

MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCW      1 - 70
CNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCEIDTRATCYEDQGISYRGTWS     71 - 140
TAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHNYCRNPDRDSKPWCYVFKAGKYSSEFCSTPACSE    141 - 210
GNSDCYFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHV    211 - 280
LKNRRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSC    281 - 350
WILSAAHCFQERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCA    351 - 420
QESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQHLLNRTVTDNM    421 - 490
LCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNM    491 - 560
RP                                                                        561 - 562
//

Text Mined References (331)

PMID Year Title
26942412 2016 Plasma tPA-Activity and Progression of Cerebral White Matter Hyperintensities in Lacunar Stroke Patients.
26881424 2016 Release of Matrix Metalloproteinases-2 and 9 by S-Nitrosylated Caveolin-1 Contributes to Degradation of Extracellular Matrix in tPA-Treated Hypoxic Endothelial Cells.
26704613 2016 Interferons Induce STAT1-Dependent Expression of Tissue Plasminogen Activator, a Pathogenicity Factor in Puumala Hantavirus Disease.
26548921 2016 Distinct encounter complexes of PAI-1 with plasminogen activators and vitronectin revealed by changes in the conformation and dynamics of the reactive center loop.
26528141 2015 Impacts of tissue-type plasminogen activator (tPA) on neuronal survival.
26469972 2015 Conformations of tissue plasminogen activator (tPA) orchestrate neuronal survival by a crosstalk between EGFR and NMDAR.
26339655 2015 Concordance of Hypermethylated DNA and the Tumor Markers CA 15-3, CEA, and TPA in Serum during Monitoring of Patients with Advanced Breast Cancer.
26324706 2015 Crystal Structure of the Michaelis Complex between Tissue-type Plasminogen Activator and Plasminogen Activators Inhibitor-1.
26002716 2015 Dynamic changes in plasma tissue plasminogen activator, plasminogen activator inhibitor-1 and beta-thromboglobulin content in ischemic stroke.
25970741 2016 Adiponectin, C-reactive protein, fibrinogen and tissue plasminogen activator antigen levels among glucose-intolerant women with and without histories of gestational diabetes.
More...