Property Summary

Ligand Count 76
NCBI Gene PubMed Count 341
PubMed Score 5819.27
PubTator Score 3070.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Myocardial Infarction 151 6.882 3.4
Pulmonary embolism 55 6.206 3.1
Coronary thrombosis 3 5.298 2.6
Hypertension 396 4.286 2.1
Atherosclerosis 291 4.152 2.1
Aphasia 26 3.78 1.9
Brain Ischemia 110 3.752 1.9
Angioedema 38 3.455 1.7
Acidosis, Lactic 97 0.0 0.0
Airway Obstruction 3 0.0 0.0
Amphetamine-Related Disorders 74 0.0 0.0
Arterial Occlusive Diseases 3 0.0 0.0
Back Pain 7 0.0 0.0
Bacteremia 3 0.0 0.0
Brain infarction 22 0.0 0.0
Cardiac tamponade 4 0.0 0.0
Cerebral Hemorrhage 42 0.0 0.0
Cerebral Infarction 10 0.0 0.0
Chemical and Drug Induced Liver Injury 195 0.0 0.0
Dermatitis, Allergic Contact 67 0.0 0.0
Embolism 2 0.0 0.0
Embolism and Thrombosis 6 0.0 0.0
Embolism, Cholesterol 2 0.0 0.0
Heart failure 162 0.0 0.0
Hematoma, Epidural, Spinal 1 0.0 0.0
Hematoma, Subdural 1 0.0 0.0
Hemorrhage 19 0.0 0.0
Hypotension 82 0.0 0.0
Hypoxia 33 0.0 0.0
Infarction, Middle Cerebral Artery 33 0.0 0.0
Intracranial Embolism and Thrombosis 2 0.0 0.0
Intracranial Hemorrhages 16 0.0 0.0
Intracranial Thrombosis 3 0.0 0.0
Liver Cirrhosis, Experimental 769 0.0 0.0
Low Back Pain 5 0.0 0.0
Meningoencephalitis 13 0.0 0.0
Nerve Degeneration 121 0.0 0.0
Neurotoxicity Syndromes 26 0.0 0.0
Paresis 2 0.0 0.0
Pericardial effusion 14 0.0 0.0
Reperfusion Injury 86 0.0 0.0
Respiratory Insufficiency 132 0.0 0.0
Shock, Cardiogenic 3 0.0 0.0
Spinal Cord Compression 3 0.0 0.0
Stroke 33 0.0 0.0
THROMBOPHILIA, FAMILIAL, DUE TO DECREASED RELEASE OF TISSUE PLASMINOGEN ACTIVATOR;THPH9 HYPERFIBRINOLYSIS, FAMILIAL, DUE TO INCREASED RELEASE OF TISSUE PLASMINOGEN 1 0.0 0.0
Thromboembolism 15 0.0 0.0
Thrombosis 46 0.0 0.0
Vasospasm, Intracranial 5 0.0 0.0
Venous Thromboembolism 8 0.0 0.0
Venous Thrombosis 47 0.0 0.0
Ventricular Dysfunction, Left 22 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count
THPH9 1

Expression

  Differential Expression (24)

Disease log2 FC p
adrenocortical carcinoma -2.846 1.1e-06
adult high grade glioma 1.600 2.4e-03
Astrocytoma, Pilocytic 3.200 6.0e-13
Atopic dermatitis 1.200 4.2e-02
Barrett's esophagus 1.700 2.7e-02
Breast cancer -2.200 5.3e-04
breast carcinoma -1.400 6.7e-12
chronic rhinosinusitis 1.832 8.5e-03
colon cancer -1.400 3.2e-02
cystic fibrosis 2.292 2.6e-07
ependymoma -1.100 1.9e-02
fibroadenoma 2.100 2.3e-03
glioblastoma 2.500 8.2e-08
group 4 medulloblastoma -1.200 4.1e-04
intraductal papillary-mucinous adenoma (... -1.400 2.5e-02
lung carcinoma 1.100 3.6e-07
malignant mesothelioma -4.500 1.5e-09
oligodendroglioma -1.200 1.2e-02
ovarian cancer -1.900 2.9e-03
pancreatic cancer 1.700 4.3e-03
periodontitis 1.400 8.2e-31
primary pancreatic ductal adenocarcinoma 4.075 1.9e-04
psoriasis 1.700 4.2e-03
ulcerative colitis 1.600 1.8e-04

 CSPA Cell Line (3)

Gene RIF (273)

AA Sequence

MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCW      1 - 70
CNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCEIDTRATCYEDQGISYRGTWS     71 - 140
TAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHNYCRNPDRDSKPWCYVFKAGKYSSEFCSTPACSE    141 - 210
GNSDCYFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHV    211 - 280
LKNRRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSC    281 - 350
WILSAAHCFQERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCA    351 - 420
QESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQHLLNRTVTDNM    421 - 490
LCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNM    491 - 560
RP                                                                        561 - 562
//

Text Mined References (343)

PMID Year Title