Property Summary

Ligand Count 475
NCBI Gene PubMed Count 513
PubMed Score 1960.23
PubTator Score 2077.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Adenocarcinoma 122 0.0 0.0
Alzheimer Disease 83 0.0 0.0
Angina Pectoris 32 0.0 0.0
Angina, Unstable 3 0.0 0.0
Anuria 9 0.0 0.0
Arterial Occlusive Diseases 3 0.0 0.0
Asthenozoospermia 3 0.0 0.0
Asthma 385 0.0 0.0
Bone neoplasms 8 0.0 0.0
Brain Edema 50 0.0 0.0
Brain Ischemia 110 0.0 0.0
Carcinoma, Transitional Cell 32 0.0 0.0
Carotid Artery Diseases 11 0.0 0.0
Cerebral Hemorrhage 42 0.0 0.0
Cerebral Infarction 10 0.0 0.0
Cerebrovascular Disorders 2 0.0 0.0
Coronary Disease 25 0.0 0.0
Embolism, Cholesterol 2 0.0 0.0
Glomerulonephritis, IGA 34 0.0 0.0
Graft Occlusion, Vascular 1 0.0 0.0
Heart Rupture, Post-Infarction 1 0.0 0.0
Hematuria 36 0.0 0.0
Hemorrhage 19 0.0 0.0
Hypotension 82 0.0 0.0
Idiopathic pulmonary fibrosis 23 0.0 0.0
Infarction, Middle Cerebral Artery 33 0.0 0.0
Intracranial Embolism and Thrombosis 2 0.0 0.0
Intracranial Hemorrhages 16 0.0 0.0
Ischemia 28 0.0 0.0
Liver Cirrhosis 181 0.0 0.0
Liver Cirrhosis, Experimental 769 0.0 0.0
Myocardial Infarction 151 0.0 0.0
Neoplasm Invasiveness 161 0.0 0.0
Neoplasm Metastasis 168 0.0 0.0
Neoplasm Recurrence, Local 37 0.0 0.0
Nephritis 51 0.0 0.0
Pancreatic Neoplasms 85 0.0 0.0
Prostatic Neoplasms 495 0.0 0.0
Pulmonary embolism 55 0.0 0.0
Purpura, Schoenlein-Henoch 2 0.0 0.0
Quebec platelet disorder 2 0.0 0.0
Reperfusion Injury 86 0.0 0.0
Sagittal Sinus Thrombosis 3 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Stroke 33 0.0 0.0
Thromboembolism 15 0.0 0.0
Thrombosis 46 0.0 0.0
Venous Thrombosis 47 0.0 0.0
Ventricular Fibrillation 17 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0
substance-related disorder 162 0.0 0.7

Expression

  Differential Expression (28)

Disease log2 FC p
active ulcerative colitis 1.015 4.6e-02
adult high grade glioma 2.000 4.1e-03
Astrocytoma, Pilocytic 2.800 2.2e-08
Atopic dermatitis 1.300 2.3e-04
atypical teratoid / rhabdoid tumor 2.700 2.3e-04
Breast cancer 2.600 2.5e-02
colon cancer 1.700 8.0e-03
cystic fibrosis 2.596 4.6e-06
ependymoma 1.300 2.7e-03
gastric carcinoma 2.000 2.7e-02
glioblastoma 1.500 9.8e-04
interstitial cystitis 1.800 2.2e-04
interstitial lung disease 1.100 4.3e-02
intraductal papillary-mucinous adenoma (... -1.600 7.3e-03
invasive ductal carcinoma 1.332 4.7e-02
lung adenocarcinoma 1.300 2.3e-06
medulloblastoma, large-cell 1.400 6.4e-05
Multiple Sclerosis -1.100 6.5e-04
nasopharyngeal carcinoma 1.500 1.6e-05
non diabetic and post-ischemic heart fai... -1.200 2.6e-03
non-small cell lung cancer 1.871 8.5e-13
osteosarcoma 2.359 2.5e-03
ovarian cancer 3.900 3.5e-05
pancreatic cancer 2.000 3.6e-05
pancreatic ductal adenocarcinoma liver m... 1.327 2.8e-02
primitive neuroectodermal tumor 1.300 1.9e-02
psoriasis 1.700 1.5e-04
tuberculosis -1.800 1.4e-05

Synonym

Accession P00749 B4DPZ2 Q15844 Q16618 Q53XS3 Q5SWW9 Q969W6 U-plasminogen activator
Symbols ATF
QPD
UPA
URK
u-PA
BDPLT5

Gene

PANTHER Protein Class (3)

PDB

1C5W   1C5X   1C5Y   1C5Z   1EJN   1F5K   1F5L   1F92   1FV9   1GI7   1GI8   1GI9   1GJ7   1GJ8   1GJ9   1GJA   1GJB   1GJC   1GJD   1KDU   1LMW   1O3P   1O5A   1O5B   1O5C   1OWD   1OWE   1OWH   1OWI   1OWJ   1OWK   1SC8   1SQA   1SQO   1SQT   1U6Q   1URK   1VJ9   1VJA   1W0Z   1W10   1W11   1W12   1W13   1W14   2FD6   2I9A   2I9B   2NWN   2O8T   2O8U   2O8W   2R2W   2VIN   2VIO   2VIP   2VIQ   2VIV   2VIW   2VNT   3BT1   3BT2   3IG6   3KGP   3KHV   3KID   3M61   3MHW   3MWI   3OX7   3OY5   3OY6   3PB1   3QN7   3U73   4DVA   4DW2   4FU7   4FU8   4FU9   4FUB   4FUC   4FUD   4FUE   4FUF   4FUG   4FUH   4FUI   4FUJ   4GLY   4H42   4JK5   4JK6   4JNI   4JNL   4K24   4MNV   4MNW   4MNX   4MNY   4OS1   4OS2   4OS4   4OS5   4OS6   4OS7   4X0W   4X1N   4X1P   4X1Q   4X1R   4X1S   4XSK   4ZHL   4ZHM   4ZKN   4ZKO   4ZKR   4ZKS   5HGG   5XG4  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (2)

Gene RIF (451)

AA Sequence

MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTC      1 - 70
YEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLK     71 - 140
PLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCG    141 - 210
GSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLK    211 - 280
IRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHY    281 - 350
YGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIR    351 - 420
SHTKEENGLAL                                                               421 - 431
//

Text Mined References (516)

PMID Year Title