Property Summary

NCBI Gene PubMed Count 499
Grant Count 175
R01 Count 112
Funding $15,132,531.55
PubMed Score 1988.79
PubTator Score 2077.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (81)

Disease Z-score Confidence
Cancer 2,346 5.797 2.9
Acute myocardial infarction 3 3.662 1.8
Severe Combined Immunodeficiency 46 3.617 1.8
Adenocarcinoma 115
Alzheimer's disease 644
Angina pectoris 21
Angina, Unstable 3
Anuria 6
Arterial Occlusive Diseases 3
Asthenozoospermia 3
Asthma 349
Atopic dermatitis 944
Bone neoplasms 7
Brain Ischemia 87
Brain edema 26
Breast cancer 3,094
Carcinoma, Transitional Cell 31
Carotid Artery Diseases 11
Cerebral Hemorrhage 27
Cerebral Infarction 9
Cerebrovascular Disorders 2
Cerebrovascular accident 44
Cholesterol embolism 5
Coronary heart disease 59
Crohn's disease 304 2.0
Graft Occlusion, Vascular 1
Heart Rupture, Post-Infarction 1
Hematuria 5
Hemorrhage 18
Henoch-Schoenlein purpura 13
Hypotension 53
IGA Glomerulonephritis 454
Idiopathic pulmonary fibrosis 21
Infarction, Middle Cerebral Artery 25
Inflammatory Bowel Diseases 87
Intracranial Embolism and Thrombosis 2
Intracranial Hemorrhages 4
Ischemia 27
Liver Cirrhosis 101
Multiple Sclerosis 498
Myocardial Infarction 126
Neoplasm Invasiveness 127
Neoplasm Metastasis 138
Neoplasm Recurrence, Local 23
Nephritis 29
Pancreatic Neoplasm 79
Prostatic Neoplasms 471
Pulmonary Embolism 45
Quebec platelet disorder 1
Reperfusion Injury 84
Sagittal Sinus Thrombosis 3
Stomach Neoplasms 282
Thromboembolism 12
Thrombosis 42
Venous Thrombosis 21
Ventricular Fibrillation 10
adult high grade glioma 2,148
atypical teratoid / rhabdoid tumor 4,369
colon cancer 1,475
cystic fibrosis 1,665
ependymoma 2,514
gastric carcinoma 832
glioblastoma 5,572
interstitial cystitis 2,299
interstitial lung disease 291
intraductal papillary-mucinous adenoma (... 2,956 
invasive ductal carcinoma 2,950
lung adenocarcinoma 2,713
medulloblastoma, large-cell 6,234
nasopharyngeal carcinoma 1,056
non diabetic and post-ischemic heart fai... 200 
non-small cell lung cancer 2,798
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic cancer 2,300
pilocytic astrocytoma 3,086
primary pancreatic ductal adenocarcinoma 1,271
primitive neuroectodermal tumor 3,031
psoriasis 6,685
tuberculosis 1,557
ulcerative colitis 2,087

Expression

Synonym

Accession P00749 B4DPZ2 Q15844 Q16618 Q53XS3 Q5SWW9 Q969W6 U-plasminogen activator
Symbols ATF
QPD
UPA
URK
u-PA
BDPLT5

Gene

PANTHER Protein Class (3)

PDB

1C5W   1C5X   1C5Y   1C5Z   1EJN   1F5K   1F5L   1F92   1FV9   1GI7   1GI8   1GI9   1GJ7   1GJ8   1GJ9   1GJA   1GJB   1GJC   1GJD   1KDU   1LMW   1O3P   1O5A   1O5B   1O5C   1OWD   1OWE   1OWH   1OWI   1OWJ   1OWK   1SC8   1SQA   1SQO   1SQT   1U6Q   1URK   1VJ9   1VJA   1W0Z   1W10   1W11   1W12   1W13   1W14   2FD6   2I9A   2I9B   2NWN   2O8T   2O8U   2O8W   2R2W   2VIN   2VIO   2VIP   2VIQ   2VIV   2VIW   2VNT   3BT1   3BT2   3IG6   3KGP   3KHV   3KID   3M61   3MHW   3MWI   3OX7   3OY5   3OY6   3PB1   3QN7   3U73   4DVA   4DW2   4FU7   4FU8   4FU9   4FUB   4FUC   4FUD   4FUE   4FUF   4FUG   4FUH   4FUI   4FUJ   4GLY   4H42   4JK5   4JK6   4JNI   4JNL   4K24   4MNV   4MNW   4MNX   4MNY   4OS1   4OS2   4OS4   4OS5   4OS6   4OS7   4X0W   4X1N   4X1P   4X1Q   4X1R   4X1S   4XSK   4ZHL   4ZHM   4ZKN   4ZKO   4ZKR   4ZKS   5HGG  

 IMPC Term (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
720519 confirmatory 16 / 44 / 827 qHTS for Inhibitors of Cell Surface uPA Generation: Confirmatory Assay for Cherry-picked Compounds

Gene RIF (438)

PMID Text
26978018 The morphologically normal tissue adjacent to the tumor shows the substantial expression of MMP-2 and MMP-9 and in some cases the enhanced activity of uPA and ACE, which makes an additional contribution to the increased invasive potential of tumor
26846181 Significance of the urokinase-type plasminogen activator and its receptor in the progression of focal segmental glomerulosclerosis in clinical and mouse models.
26782341 1,25D3 works as a modifier of NF-kappaB/GPX1/uPA expression, inhibiting cisplatin-resistance and cell invasive ability of salivary adenoid cystic carcinoma cells
26707376 Resveratrol inhibited hypoxia-induced HIF-1alpha protein expression. Resveratrol also suppressed hypoxiainduced expression of metastatic-related factors, uPA and MMP2.
26643086 These findings strongly support the use of uPA/PAI-1 together with clinic-pathological parameters as an evidence-based, clinically relevant and inexpensive decision tool in the routine of a breast center.
26504024 High cytoplasmic expression of uPA is associated with cells of rectal cancer and metastases of perienteric lymph nodes.
26317203 Results found high levels of uPA and uPAR exclusively in metastatic osteosarcoma (OS)cells and suggest that malignant conversion of OS cells to uPA/uPAR axis in an autocrine and paracrine fashion.
26166362 it was found that the recombinant fusion protein uPA17-34-KPI(kunitz-type protease inhibitor ) inhibited the invasion and metastasis of ovarian tumors
26050228 data on the stromal macrophages immunoreactivity of uPAR, MMP-2, and MMP-9 in a few small cell lung cancer (SCLC) and lung squamous cell carcinoma (SCC) biopsies was included. uPAR, MMP-2, and MMP-9 were confirmed in stromal cells including macrophages
26033187 u-PA is a dysregulated gene involved in the tumorigenesis, bio-pathological features and outcomes of EEC.
More...

AA Sequence

MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTC      1 - 70
YEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLK     71 - 140
PLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCG    141 - 210
GSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLK    211 - 280
IRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHY    281 - 350
YGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIR    351 - 420
SHTKEENGLAL                                                               421 - 431
//

Text Mined References (502)

PMID Year Title
26978018 [Matrix metalloproteinases 2 and 9, their endogenous regulators, and angiotensin-converting enzyme in cervical squamous cell carcinoma].
26846181 2016 Significance of the urokinase-type plasminogen activator and its receptor in the progression of focal segmental glomerulosclerosis in clinical and mouse models.
26782341 2016 1,25-Dihydroxyvitamin D3 alleviates salivary adenoid cystic carcinoma progression by suppressing GPX1 expression through the NF-?B pathway.
26707376 2016 Resveratrol inhibits hypoxia-driven ROS-induced invasive and migratory ability of pancreatic cancer cells via suppression of the Hedgehog signaling pathway.
26643086 2016 Impact of guideline-based use of uPA/PAI-1 on patient outcome in intermediate-risk early breast cancer.
26504024 2015 Plasminogen Activation System in Rectal Adenocarcinoma.
26317203 2015 Progression of Osteosarcoma from a Non-Metastatic to a Metastatic Phenotype Is Causally Associated with Activation of an Autocrine and Paracrine uPA Axis.
26166362 2015 Expression and activity analysis of a new fusion protein targeting ovarian cancer cells.
26050228 2015 Macrophages of M1 phenotype have properties that influence lung cancer cell progression.
26033187 2015 Urokinase-type plasminogen activator resulting from endometrial carcinogenesis enhances tumor invasion and correlates with poor outcome of endometrial carcinoma patients.
More...