Property Summary

Ligand Count 8
NCBI Gene PubMed Count 182
PubMed Score 729.43
PubTator Score 895.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Vascular disease 319 0.0 3.0

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma 1.200 1.2e-03
Astrocytoma, Pilocytic 1.500 5.1e-06
Atopic dermatitis 1.400 4.6e-04
Breast cancer 1.400 7.3e-08
breast carcinoma 1.100 1.4e-02
cystic fibrosis -1.114 1.1e-04
ductal carcinoma in situ 1.500 4.7e-03
ependymoma -1.100 1.4e-02
group 3 medulloblastoma 1.100 2.0e-02
intraductal papillary-mucinous neoplasm ... 1.600 3.2e-03
invasive ductal carcinoma 1.500 1.5e-03
lung adenocarcinoma 1.700 2.3e-11
lung cancer 1.400 9.9e-04
non-small cell lung cancer 2.240 8.4e-22
ovarian cancer 1.300 1.8e-05
psoriasis 1.100 1.6e-08

Protein-protein Interaction (2)

Gene RIF (150)

AA Sequence

MRALLLLGFLLVSLESTLSIPPWEAPKEHKYKAEEHTVVLTVTGEPCHFPFQYHRQLYHKCTHKGRPGPQ      1 - 70
PWCATTPNFDQDQRWGYCLEPKKVKDHCSKHSPCQKGGTCVNMPSGPHCLCPQHLTGNHCQKEKCFEPQL     71 - 140
LRFFHKNEIWYRTEQAAVARCQCKGPDAHCQRLASQACRTNPCLHGGRCLEVEGHRLCHCPVGYTGAFCD    141 - 210
VDTKASCYDGRGLSYRGLARTTLSGAPCQPWASEATYRNVTAEQARNWGLGGHAFCRNPDNDIRPWCFVL    211 - 280
NRDRLSWEYCDLAQCQTPTQAAPPTPVSPRLHVPLMPAQPAPPKPQPTTRTPPQSQTPGALPAKREQPPS    281 - 350
LTRNGPLSCGQRLRKSLSSMTRVVGGLVALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPAP    351 - 420
EDLTVVLGQERRNHSCEPCQTLAVRSYRLHEAFSPVSYQHDLALLRLQEDADGSCALLSPYVQPVCLPSG    421 - 490
AARPSETTLCQVAGWGHQFEGAEEYASFLQEAQVPFLSLERCSAPDVHGSSILPGMLCAGFLEGGTDACQ    491 - 560
GDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYTDVAYYLAWIREHTVS                   561 - 615
//

Text Mined References (186)

PMID Year Title